7 products were found matching "Q5JR98"!

No results were found for the filter!
Anti-TCTEX1D4
Anti-TCTEX1D4

Item number: ATA-HPA062652.100

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 79% and to rat: 81%
Keywords: Anti-TCTEX1D4, Anti-Tctex-2-beta, Anti-Protein N22.1, Anti-Dynein light chain Tctex-type 4, Anti-Tctex1 domain-containing...
Application: IHC
Host: Rabbit
Species reactivity: human
From 369.00€ *
Review
Anti-DYNLT4
Anti-DYNLT4

Item number: ATA-HPA050116.100

Polyclonal Antibody against Human DYNLT4, Gene description: dynein light chain Tctex-type 4, Alternative Gene Names: TCTEX1D4, Validated applications: ICC, Uniprot ID: Q5JR98, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 74% Rat gene identity: 74%
Keywords: Anti-TCTEX1D4, Anti-Tctex-2-beta, Anti-Protein N22.1, Anti-Dynein light chain Tctex-type 4, Anti-Tctex1 domain-containing...
Application: ICC
Host: Rabbit
Species reactivity: human
463.00€ *
Review
NEW
Anti-DYNLT4
Anti-DYNLT4

Item number: ATA-HPA050116.25

Polyclonal Antibody against Human DYNLT4, Gene description: dynein light chain Tctex-type 4, Alternative Gene Names: TCTEX1D4, Validated applications: ICC, Uniprot ID: Q5JR98, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 74% Rat gene identity: 74%
Keywords: Anti-TCTEX1D4, Anti-Tctex-2-beta, Anti-Protein N22.1, Anti-Dynein light chain Tctex-type 4, Anti-Tctex1 domain-containing...
Application: ICC
Host: Rabbit
Species reactivity: human
323.00€ *
Review
Anti-TDRG1
Anti-TDRG1

Item number: 600-401-FB5

Anti-TDRG1 Antibody was affinity purified from monospecific antiserum by immunoaffinity chromatography. TDRG1 antibody is human reactive.
Keywords: Anti-TCTEX1D4, Anti-Tctex-2-beta, Anti-Protein N22.1, Anti-Tctex1 domain-containing protein 4
Application: ELISA, WB
Host: Rabbit
Species reactivity: human
848.00€ *
Review
TCTEX1D4 PrEST Antigen
TCTEX1D4 PrEST Antigen

Item number: ATA-APrEST86150.100

Buffer: PBS and 1M Urea, pH 7.4.
Keywords: TCTEX1D4, Tctex-2-beta, Protein N22.1, Dynein light chain Tctex-type 4, Tctex1 domain-containing protein 4
Application: Control antigen
Expressed in: E.coli
Origin: human
264.00€ *
Review
Anti-TC1D4
Anti-TC1D4

Item number: ELK-ES12782.100

Recommended dilutions: WB 1:500-2000. Cellular localization: Cell projection, cilium, flagellum . Cytoplasmic vesicle, secretory vesicle, acrosome . Cytoplasm, cytoskeleton, cilium axoneme . Cytoplasm . Nucleus . Cytoplasm, cytoskeleton, microtubule organizing center . Present along the entire length of the...
Keywords: Anti-TCTEX1D4, Anti-Tctex-2-beta, Anti-Protein N22.1, Anti-Dynein light chain Tctex-type 4, Anti-Tctex1 domain-containing...
Application: WB
Host: Rabbit
Species reactivity: human, mouse
From 173.00€ *
Review
DYNLT4 PrEST Antigen
DYNLT4 PrEST Antigen

Item number: ATA-APrEST95685.100

PrEST Antigen DYNLT4, Gene description: dynein light chain Tctex-type 4, Alternative Gene Names: TCTEX1D4, Antigen sequence: LVRELCEQVHVRLRELSPPRYKLVCSVVLGPRAGQGVHVVSRALWDVARDGLASVSYTNTSLFAVATVHGLYCE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 74% Rat gene...
Keywords: TCTEX1D4, Tctex-2-beta, Protein N22.1, Dynein light chain Tctex-type 4, Tctex1 domain-containing protein 4
Expressed in: E.coli
Origin: human
264.00€ *
Review