DYNC1LI2 PrEST Antigen

DYNC1LI2 PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST95624.100 100 µl

3 - 8 business days*

264.00€
 
PrEST Antigen DYNC1LI2, Gene description: dynein cytoplasmic 1 light intermediate chain 2,... more
Product information "DYNC1LI2 PrEST Antigen"
PrEST Antigen DYNC1LI2, Gene description: dynein cytoplasmic 1 light intermediate chain 2, Alternative Gene Names: DNCLI2, Antigen sequence: PGSPGAGGVQSTAKKSGQKTVLSNVQEELDRMTRKPDSMVTNSSTE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. May play a role in binding dynein to membranous organelles or chromosomes. [The UniProt Consortium] Mouse gene identity: 98% Rat gene identity: 98%
Keywords: LIC-2, DNCLI2, LIC53/55, DYNC1LI2, Dynein light intermediate chain 2, cytosolic, Cytoplasmic dynein 1 light intermediate chain 2
Supplier: Atlas Antibodies
Supplier-Nr: APrEST95624

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "DYNC1LI2 PrEST Antigen"
Write a review
or to review a product.
Viewed