- Search results for O43237
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
10 products were found matching "O43237"!
Close filters
Filter by:
No results were found for the filter!
Item number: ATA-HPA057201.100
Protein function: Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles...
| Keywords: | Anti-LIC-2, Anti-DNCLI2, Anti-LIC53/55, Anti-DYNC1LI2, Anti-Dynein light intermediate chain 2, cytosolic, Anti-Cytoplasmic... |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
From 246.00€
*
Item number: ATA-HPA049538.100
Polyclonal Antibody against Human DYNC1LI2, Gene description: dynein cytoplasmic 1 light intermediate chain 2, Alternative Gene Names: DNCLI2, Validated applications: IHC, WB, Uniprot ID: O43237, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Acts as one...
| Keywords: | Anti-LIC-2, Anti-DNCLI2, Anti-LIC53/55, Anti-DYNC1LI2, Anti-Dynein light intermediate chain 2, cytosolic, Anti-Cytoplasmic... |
| Application: | IHC, WB |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Item number: ABS-PP-7532-L.100
Protein function: Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles...
| Keywords: | Cytoplasmic dynein 1 light intermediate chain 2, Dynein light intermediate chain 2, cytosolic, LIC-2, LIC53/55,... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 15.5 kD |
From 115.00€
*
Item number: VHPS-2687
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Keywords: | LIC-2, DNCLI2, DYNC1LI2, LIC53/55, Dynein light intermediate chain 2, cytosolic, Cytoplasmic dynein 1 light intermediate... |
| Application: | RNA quantification |
45.00€
*
Item number: 034873.200
Cytoplasmic dynein is a microtubule-associated motor protein (Hughes et al., 1995 [PubMed 7738094]). See DYNC1H1 (MIM 600112) for general information about dyneins. Applications: Suitable for use in Western Blot, Immunohistochemistry, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500,...
| Keywords: | Anti-LIC-2, Anti-DNCLI2, Anti-DYNC1LI2, Anti-LIC53/55, Anti-Dynein light intermediate chain 2, cytosolic, Anti-Cytoplasmic... |
| Application: | ELISA, IHC, WB |
| Host: | Rabbit |
| Species reactivity: | human |
865.00€
*
Item number: ATA-APrEST91790.100
Protein function: Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles...
| Keywords: | LIC-2, DNCLI2, LIC53/55, DYNC1LI2, Dynein light intermediate chain 2, cytosolic, Cytoplasmic dynein 1 light intermediate... |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: G-CAB20592.20
Protein function: Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles...
| Keywords: | Anti-LIC-2, Anti-DNCLI2, Anti-DYNC1LI2, Anti-LIC53/55, Anti-Dynein light intermediate chain 2, cytosolic, Anti-Cytoplasmic... |
| Application: | WB, IHC |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
103.00€
*
Item number: CSB-PA007296GA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.02% Sodium Azide, 50% Glycerol, pH 7.3. -20°C, Avoid freeze / thaw cycles. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: DYNC1LI2. Antigen Species: Human
| Keywords: | Anti-LIC-2, Anti-DNCLI2, Anti-LIC53/55, Anti-DYNC1LI2, Anti-Dynein light intermediate chain 2, cytosolic, Anti-Cytoplasmic... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
552.00€
*
Item number: ABS-PP-7532.100
Protein function: Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles...
| Keywords: | Cytoplasmic dynein 1 light intermediate chain 2, Dynein light intermediate chain 2, cytosolic, LIC-2, LIC53/55,... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 15.5 kD |
From 90.00€
*
Item number: ATA-APrEST95624.100
PrEST Antigen DYNC1LI2, Gene description: dynein cytoplasmic 1 light intermediate chain 2, Alternative Gene Names: DNCLI2, Antigen sequence: PGSPGAGGVQSTAKKSGQKTVLSNVQEELDRMTRKPDSMVTNSSTE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Acts as one of several non-catalytic...
| Keywords: | LIC-2, DNCLI2, LIC53/55, DYNC1LI2, Dynein light intermediate chain 2, cytosolic, Cytoplasmic dynein 1 light intermediate... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*