Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
Recombinant protein corresponding to Pro344-Asp497 with an N-Terminal His-Tag from human... more
Product information "Cytochrome P450 3A7 (CYP3A7) Recombinant, Human"
Recombinant protein corresponding to Pro344-Asp497 with an N-Terminal His-Tag from human CYP3A7expressed in E. coli (P24462). Amino Acid Sequence: PPTYDTVLQLEYLDMVVNETLRLFPVAMRLERVCKKDVEINGMFIPKGVVVMIPSYVLHHDPKYWREPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALVNMKLALVRVLQNFSFKPCKETQIPLKLRFGGLLLTEKPIVLKAESRD, Predicted Molecular Mass: 19.1kD, Predicted Isoelectric Point: 9.3, Accurate Molecular Mass: 21kD as determined by SDS-PAGE reducing conditions, Subcellular Location: Endoplasmic reticulum membrane. Peripheral membrane protein, Tissue Specificity: Liver, Applications: Suitable for use in ELISA, Western Blot and SDS-PAGE. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Included Protein Molecular Weight Marker: 168631: Unstained Protein Molecular Weight Marker, 10-70kD, Suppled as a liquid in 62.5mM Tris-H3PO4, pH 7.5, 1mM EDTA, 2% SDS, 100mM DTT, 1mM sodium azide, 0.01% bromo-phenol blue, 33% glycerol. Ready to use, no need to heat, dilute or add reducing agents before use. Protein Bands: 10kD, 14kD, 18kD, 22kD, 26kD, 33kD, 44kD and 70kD. Double Intesity Bands: The 26kD, 18kD and 10kD bands are at double intensity to make location and size approximation of proteins easier. Usage: Allow the marker to reach room temperature and mix thoroughly before use to ensure that any solids that may have precipitated at -20°C will go back into solution. Do not boil! Load the following volumes on SDS-PAGE gel: Mini gels: 3-5ul/well, Large gel: 7ul/well, The loading volumes listed above are recommended for gels with thickness of 0.75-1mm. The loading volume should be doubled for 1.5mm thick gels., Store at -20°C Stable for 6 months after receipt. Storage and Stability: Lyophilized powder may be stored at -70°C. Stable for 6 months after receipt. Reconstitute with sterile 20mM Tris, 150Mm sodium chloride, pH 8.0. Aliquot to avoid repeated freezing and thawing. Store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. Note: Thermal stability is described by the loss rate of the target protein. The loss rate was determined by accelerated thermal degradation by incubating the protein at 37°C for 48h, with no obvious degradation or precipitation observed. Protein loss is <5% within the expiration date under appropriate storage conditions.
| Supplier: | United States Biological |
| Supplier-Nr: | 154299 |
Properties
| Conjugate: | No |
| Format: | Highly Purified |
Database Information
| UniProt ID : | P24462 | Matching products |
Handling & Safety
| Storage: | vT |
| Shipping: | +4°C (International: °C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed