Cytochrome P450 3A7 (CYP3A7) Recombinant, Human

Cytochrome P450 3A7 (CYP3A7) Recombinant, Human
Item number Size Datasheet Manual SDS Delivery time Quantity Price
154299.10 10 µg - -

3 - 19 business days*

445.00€
154299.50 50 µg - -

3 - 19 business days*

715.00€
154299.200 200 µg - -

3 - 19 business days*

1,112.00€
 
Recombinant protein corresponding to Pro344-Asp497 with an N-Terminal His-Tag from human... more
Product information "Cytochrome P450 3A7 (CYP3A7) Recombinant, Human"
Recombinant protein corresponding to Pro344-Asp497 with an N-Terminal His-Tag from human CYP3A7expressed in E. coli (P24462). Amino Acid Sequence: PPTYDTVLQLEYLDMVVNETLRLFPVAMRLERVCKKDVEINGMFIPKGVVVMIPSYVLHHDPKYWREPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALVNMKLALVRVLQNFSFKPCKETQIPLKLRFGGLLLTEKPIVLKAESRD, Predicted Molecular Mass: 19.1kD, Predicted Isoelectric Point: 9.3, Accurate Molecular Mass: 21kD as determined by SDS-PAGE reducing conditions, Subcellular Location: Endoplasmic reticulum membrane. Peripheral membrane protein, Tissue Specificity: Liver, Applications: Suitable for use in ELISA, Western Blot and SDS-PAGE. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Included Protein Molecular Weight Marker: 168631: Unstained Protein Molecular Weight Marker, 10-70kD, Suppled as a liquid in 62.5mM Tris-H3PO4, pH 7.5, 1mM EDTA, 2% SDS, 100mM DTT, 1mM sodium azide, 0.01% bromo-phenol blue, 33% glycerol. Ready to use, no need to heat, dilute or add reducing agents before use. Protein Bands: 10kD, 14kD, 18kD, 22kD, 26kD, 33kD, 44kD and 70kD. Double Intesity Bands: The 26kD, 18kD and 10kD bands are at double intensity to make location and size approximation of proteins easier. Usage: Allow the marker to reach room temperature and mix thoroughly before use to ensure that any solids that may have precipitated at -20°C will go back into solution. Do not boil! Load the following volumes on SDS-PAGE gel: Mini gels: 3-5ul/well, Large gel: 7ul/well, The loading volumes listed above are recommended for gels with thickness of 0.75-1mm. The loading volume should be doubled for 1.5mm thick gels., Store at -20°C Stable for 6 months after receipt. Storage and Stability: Lyophilized powder may be stored at -70°C. Stable for 6 months after receipt. Reconstitute with sterile 20mM Tris, 150Mm sodium chloride, pH 8.0. Aliquot to avoid repeated freezing and thawing. Store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. Note: Thermal stability is described by the loss rate of the target protein. The loss rate was determined by accelerated thermal degradation by incubating the protein at 37°C for 48h, with no obvious degradation or precipitation observed. Protein loss is <5% within the expiration date under appropriate storage conditions.
Supplier: United States Biological
Supplier-Nr: 154299

Properties

Conjugate: No
Format: Highly Purified

Database Information

UniProt ID : P24462 | Matching products

Handling & Safety

Storage: vT
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Cytochrome P450 3A7 (CYP3A7) Recombinant, Human"
Write a review
or to review a product.
Viewed