18 products were found matching "P24462"!
No results were found for the filter!
Human CYP3A7 (Cytochrome P450 3A7) ELISA Kit
Item number: ELK-ELK7465.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Human CYP3A7. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Human CYP3A7....
| Keywords: | CYPIIIA7, P450HLp2, Cytochrome P450 3A7, Cytochrome P450-HFLA |
| Application: | ELISA |
| Species reactivity: | human |
From 374.00€
*
Cytochrome P450 3A7 (CYP3A7), human, recombinant
Item number: CSB-EP006444HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 1-503aa. Protein Length: Full Length. Tag Info: C-terminal 6xHis-tagged. Target Protein Sequence: MDLIPNLAVE TWLLLAVSLI LLYLYGTRTH GLFKKLGIPG PTPLPFLGNA LSFRKGYWTF DMECYKKYRK VWGIYDCQQP MLAITDPDMI KTVLVKECYS VFTNRRPFGP VGFMKNAISI AEDEEWKRIR...
| Keywords: | CYPIIIA7, P450HLp2, Cytochrome P450 3A7, Cytochrome P450-HFLA, Recombinant Human Cytochrome P450 3A7 (CYP3A7) |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 64.4 kD |
From 292.00€
*
Anti-CYP3A7
Item number: CSB-PA007546.100
Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
| Keywords: | Anti-P450HLp2, Anti-CYPIIIA7, Anti-Cytochrome P450 3A7, Anti-Cytochrome P450-HFLA, Aryl hydrocarbon hydroxylase antibody,... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human |
From 126.00€
*
Anti-CYP3A7
Item number: CSB-PA929315.100
Host Species: Rabbit. Isotype: IgG. Buffer: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by...
| Keywords: | Anti-P450HLp2, Anti-CYPIIIA7, Anti-Cytochrome P450 3A7, Anti-Cytochrome P450-HFLA, Cytochrome P450, family 3, subfamily A,... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human |
284.00€
*
NEW
CYP3A7 Protein, Human, Recombinant (His)
Item number: TGM-TMPH-03881-100ug
Description: CYP3A7 Protein, Human, Recombinant (His) is expressed in E. coli with C-6xHis. The accession number is P24462.
| Keywords: | Cytochrome P450-HFLA , CYPIIIA7 , Cytochrome P450 3A7 , P450HLp2 , CYP3A7 |
| MW: | 64.4 kD |
From 93.00€
*
CYP3A7 (human), recombinant protein
Item number: ABS-PP-4400-L.100
Protein function: A cytochrome P450 monooxygenase involved in the metabolism of steroid hormones and vitamins during embryogenesis (PubMed:9555064, PubMed:11093772, PubMed:14559847, PubMed:12865317, PubMed:17178770). Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the...
| Keywords: | Cytochrome P450 3A7, CYPIIIA7, Cytochrome P450-HFLA, P450HLp2, Recombinant Human CYP3A7 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 26 kD |
From 115.00€
*
Anti-CYP3A7 (Cytochrome P450-HFLA, CYPIIIA7, Cytochrome...
Item number: C8929-04C.50
CYP3A7 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This enzyme hydroxylates testosterone and dehydroepiandrosterone 3-sulphate, which is...
| Keywords: | EC=1.14.14.1 |
| Application: | WB |
| Host: | Mouse |
| Species reactivity: | human |
850.00€
*
Cytochrome P450 3A7 (CYP3A7) Recombinant, Human
Item number: 154299.10
Recombinant protein corresponding to Pro344-Asp497 with an N-Terminal His-Tag from human CYP3A7expressed in E. coli (P24462). Amino Acid Sequence: PPTYDTVLQLEYLDMVVNETLRLFPVAMRLERVCKKDVEINGMFIPKGVVVMIPSYVLHHDPKYWREPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALVNMKLALVRVLQNFSFKPCKETQIPLKLRFGGLLLTEKPIVLKAESRD, Predicted...
From 445.00€
*
Cytochrome P450 3A7 BioAssay(TM) ELISA Kit
Item number: 471974.96
Sample Type:, Cell line of choice, Intended Use: The Cytochrome P450 3A7 Colorimetric Cell-Based ELISA allows for qualitative detection of CytochromeP4503A7 in plated and fixed cells. Sensitivity: >5000cells/well, Assay Time: 4.5 hours, Reactivity: Human, Detection Method: Colorimetric 450 nm, Format: Cell-Based...
| Keywords: | P450HLp2, CYPIIIA7, Cytochrome P450 3A7, Cytochrome P450-HFLA |
| Application: | ELISA |
| Species reactivity: | human |
920.00€
*
CYP3A7 PrEST Antigen
Item number: ATA-APrEST95317.100
Protein function: A cytochrome P450 monooxygenase involved in the metabolism of steroid hormones and vitamins during embryogenesis (PubMed:9555064, PubMed:11093772, PubMed:14559847, PubMed:12865317, PubMed:17178770). Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the...
| Keywords: | P450HLp2, CYPIIIA7, Cytochrome P450 3A7, Cytochrome P450-HFLA |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Anti-CYP3A7
Item number: ATA-HPA075539.100
Protein function: A cytochrome P450 monooxygenase involved in the metabolism of steroid hormones and vitamins during embryogenesis (PubMed:9555064, PubMed:11093772, PubMed:14559847, PubMed:12865317, PubMed:17178770). Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the...
| Keywords: | Anti-P450HLp2, Anti-CYPIIIA7, Anti-Cytochrome P450 3A7, Anti-Cytochrome P450-HFLA |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human |
From 369.00€
*
Anti-CYP3A7
Item number: ELK-ES4928.100
This gene encodes a member of the cytochrome P450 superfamily of enzymes, which participate in drug metabolism and the synthesis of cholesterol, steroids and other lipids. This enzyme hydroxylates testosterone and dehydroepiandrosterone 3-sulphate, which is involved in the formation of estriol during pregnancy. This...
| Keywords: | Anti-CYPIIIA7, Anti-P450HLp2, Anti-Cytochrome P450 3A7, Anti-Cytochrome P450-HFLA, CYP3A7 rabbit pAb |
| Application: | WB, ELISA |
| Host: | Rabbit |
| Species reactivity: | human, rat, mouse, |
From 173.00€
*