- Search results for P24462
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
18 products were found matching "P24462"!
Close filters
Filter by:
No results were found for the filter!
Item number: ELK-ELK7465.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Human CYP3A7. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Human CYP3A7....
| Keywords: | CYPIIIA7, P450HLp2, Cytochrome P450 3A7, Cytochrome P450-HFLA |
| Application: | ELISA |
| Species reactivity: | human |
From 374.00€
*
Item number: CSB-EP006444HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 1-503aa. Protein Length: Full Length. Tag Info: C-terminal 6xHis-tagged. Target Protein Sequence: MDLIPNLAVE TWLLLAVSLI LLYLYGTRTH GLFKKLGIPG PTPLPFLGNA LSFRKGYWTF DMECYKKYRK VWGIYDCQQP MLAITDPDMI KTVLVKECYS VFTNRRPFGP VGFMKNAISI AEDEEWKRIR...
| Keywords: | CYPIIIA7, P450HLp2, Cytochrome P450 3A7, Cytochrome P450-HFLA, Recombinant Human Cytochrome P450 3A7 (CYP3A7) |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 64.4 kD |
From 292.00€
*
Item number: CSB-PA007546.100
Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
| Keywords: | Anti-P450HLp2, Anti-CYPIIIA7, Anti-Cytochrome P450 3A7, Anti-Cytochrome P450-HFLA, Aryl hydrocarbon hydroxylase antibody,... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human |
From 126.00€
*
Item number: CSB-PA929315.100
Host Species: Rabbit. Isotype: IgG. Buffer: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by...
| Keywords: | Anti-P450HLp2, Anti-CYPIIIA7, Anti-Cytochrome P450 3A7, Anti-Cytochrome P450-HFLA, Cytochrome P450, family 3, subfamily A,... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human |
284.00€
*
NEW
Item number: TGM-TMPH-03881-100ug
Description: CYP3A7 Protein, Human, Recombinant (His) is expressed in E. coli with C-6xHis. The accession number is P24462.
| Keywords: | Cytochrome P450-HFLA , CYPIIIA7 , Cytochrome P450 3A7 , P450HLp2 , CYP3A7 |
| MW: | 64.4 kD |
From 93.00€
*
Item number: ABS-PP-4400-L.100
Protein function: A cytochrome P450 monooxygenase involved in the metabolism of steroid hormones and vitamins during embryogenesis (PubMed:9555064, PubMed:11093772, PubMed:14559847, PubMed:12865317, PubMed:17178770). Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the...
| Keywords: | Cytochrome P450 3A7, CYPIIIA7, Cytochrome P450-HFLA, P450HLp2, Recombinant Human CYP3A7 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 26 kD |
From 115.00€
*
Item number: C8929-04C.50
CYP3A7 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This enzyme hydroxylates testosterone and dehydroepiandrosterone 3-sulphate, which is...
| Keywords: | EC=1.14.14.1 |
| Application: | WB |
| Host: | Mouse |
| Species reactivity: | human |
850.00€
*
Item number: 154299.10
Recombinant protein corresponding to Pro344-Asp497 with an N-Terminal His-Tag from human CYP3A7expressed in E. coli (P24462). Amino Acid Sequence: PPTYDTVLQLEYLDMVVNETLRLFPVAMRLERVCKKDVEINGMFIPKGVVVMIPSYVLHHDPKYWREPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALVNMKLALVRVLQNFSFKPCKETQIPLKLRFGGLLLTEKPIVLKAESRD, Predicted...
From 445.00€
*
Item number: 471974.96
Sample Type:, Cell line of choice, Intended Use: The Cytochrome P450 3A7 Colorimetric Cell-Based ELISA allows for qualitative detection of CytochromeP4503A7 in plated and fixed cells. Sensitivity: >5000cells/well, Assay Time: 4.5 hours, Reactivity: Human, Detection Method: Colorimetric 450 nm, Format: Cell-Based...
| Keywords: | P450HLp2, CYPIIIA7, Cytochrome P450 3A7, Cytochrome P450-HFLA |
| Application: | ELISA |
| Species reactivity: | human |
920.00€
*
Item number: ATA-APrEST95317.100
Protein function: A cytochrome P450 monooxygenase involved in the metabolism of steroid hormones and vitamins during embryogenesis (PubMed:9555064, PubMed:11093772, PubMed:14559847, PubMed:12865317, PubMed:17178770). Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the...
| Keywords: | P450HLp2, CYPIIIA7, Cytochrome P450 3A7, Cytochrome P450-HFLA |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: ATA-HPA075539.100
Protein function: A cytochrome P450 monooxygenase involved in the metabolism of steroid hormones and vitamins during embryogenesis (PubMed:9555064, PubMed:11093772, PubMed:14559847, PubMed:12865317, PubMed:17178770). Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the...
| Keywords: | Anti-P450HLp2, Anti-CYPIIIA7, Anti-Cytochrome P450 3A7, Anti-Cytochrome P450-HFLA |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human |
From 369.00€
*
Item number: ELK-ES4928.100
This gene encodes a member of the cytochrome P450 superfamily of enzymes, which participate in drug metabolism and the synthesis of cholesterol, steroids and other lipids. This enzyme hydroxylates testosterone and dehydroepiandrosterone 3-sulphate, which is involved in the formation of estriol during pregnancy. This...
| Keywords: | Anti-CYPIIIA7, Anti-P450HLp2, Anti-Cytochrome P450 3A7, Anti-Cytochrome P450-HFLA, CYP3A7 rabbit pAb |
| Application: | WB, ELISA |
| Host: | Rabbit |
| Species reactivity: | human, rat, mouse, |
From 173.00€
*