23 products were found matching "P19099"!
No results were found for the filter!
Anti-CYP11B2
Item number: ATA-HPA049565.100
Polyclonal Antibody against Human CYP11B2, Gene description: cytochrome P450 family 11 subfamily B member 2, Alternative Gene Names: ALDOS, CPN2, CYP11B, CYP11BL, P-450C18, P450aldo, Validated applications: ICC, Uniprot ID: P19099, Storage: Store at +4°C for short term storage. Long time storage is recommended at...
| Keywords: | Anti-ALDOS, Anti-CYPXIB2, Anti-Cytochrome P-450C18, Anti-Cytochrome P-450Aldo, Anti-Aldosterone synthase, Anti-Steroid... |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
450.00€
*
CYP11B2 Protein, Human, Recombinant (His & SUMO)
Item number: TGM-TMPH-01181-100ug
Description: CYP11B2 Protein, Human, Recombinant (His & SUMO) is expressed in E. coli.
| Keywords: | Aldosterone-synthesizing enzyme, Cytochrome P-450Aldo, CYP11B2, Cytochrome P450 11B2, mitochondrial, CYPXIB2, Aldosterone... |
| MW: | 71.0 kD |
From 281.00€
*
Cytochrome P450 11B2, mitochondrial (CYP11B2), human,...
Item number: CSB-EP006391HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 25-503aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: GTRAARAPRT VLPFEAMPQH PGNRWLRLLQ IWREQGYEHL HLEMHQTFQE LGPIFRYNLG GPRMVCVMLP EDVEKLQQVD SLHPCRMILE PWVAYRQHRG HKCGVFLLNG...
| Keywords: | ALDOS, CYPXIB2, Cytochrome P-450C18, Aldosterone synthase, Cytochrome P-450Aldo, Steroid 18-hydroxylase,... |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 71 kD |
From 292.00€
*
Cytochrome P450 11B2, mitochondrial (CYP11B2), human,...
Item number: CSB-YP006391HU.1
Organism: Homo sapiens (Human). Source: Yeast. Expression Region: 25-503aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: GTRAARAPRT VLPFEAMPQH PGNRWLRLLQ IWREQGYEHL HLEMHQTFQE LGPIFRYNLG GPRMVCVMLP EDVEKLQQVD SLHPCRMILE PWVAYRQHRG HKCGVFLLNG PEWRFNRLRL...
| Keywords: | ALDOS, CYPXIB2, Cytochrome P-450C18, Aldosterone synthase, Cytochrome P-450Aldo, Steroid 18-hydroxylase,... |
| Application: | Activity not tested |
| Expressed in: | Yeast |
| Origin: | human |
| MW: | 57 kD |
From 347.00€
*
Anti-CYP11B2
Item number: E-AB-17738.120
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the mitochondrial inner membrane. The enzyme has...
| Keywords: | Anti-ALDOS, Anti-CYPXIB2, Anti-Cytochrome P-450C18, Anti-Aldosterone synthase, Anti-Cytochrome P-450Aldo, Anti-Steroid... |
| Application: | WB, IHC, ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 89.00€
*
Anti-CYP11B2
Item number: E-AB-66284.120
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the mitochondrial inner membrane. The enzyme has...
| Keywords: | Anti-ALDOS, Anti-CYPXIB2, Anti-Cytochrome P-450C18, Anti-Cytochrome P-450Aldo, Anti-Aldosterone synthase, Anti-Steroid... |
| Application: | IHC, IF |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
From 243.00€
*
Anti-CYP11B2
Item number: ATA-HPA049171.100
Protein function: A cytochrome P450 monooxygenase that catalyzes the biosynthesis of adrenal mineralocorticoid aldosterone (PubMed:11856349, PubMed:23322723, PubMed:1594605, PubMed:9814506). Catalyzes three sequential oxidative reactions of 11-deoxycorticosterone/21- hydroxyprogesterone, namely 11-beta hydroxylation...
| Keywords: | Anti-ALDOS, Anti-CYPXIB2, Anti-Cytochrome P-450C18, Anti-Cytochrome P-450Aldo, Anti-Aldosterone synthase, Anti-Steroid... |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 320.00€
*
Anti-CYP11B2
Item number: ATA-HPA057752.100
Protein function: A cytochrome P450 monooxygenase that catalyzes the biosynthesis of adrenal mineralocorticoid aldosterone (PubMed:11856349, PubMed:23322723, PubMed:1594605, PubMed:9814506). Catalyzes three sequential oxidative reactions of 11-deoxycorticosterone/21- hydroxyprogesterone, namely 11-beta hydroxylation...
| Keywords: | Anti-ALDOS, Anti-CYPXIB2, Anti-Cytochrome P-450C18, Anti-Cytochrome P-450Aldo, Anti-Aldosterone synthase, Anti-Steroid... |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 320.00€
*
Human ALDOS (Aldosterone Synthase) ELISA Kit
Item number: ELK-ELK5606.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Human ALDOS. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Human ALDOS. Next,...
| Keywords: | ALDOS, CYPXIB2, Cytochrome P-450C18, Cytochrome P-450Aldo, Aldosterone synthase, Steroid 18-hydroxylase,... |
| Application: | ELISA |
| Species reactivity: | human |
From 374.00€
*
Anti-CYP11B2 Recombinant
Item number: ABS-RC-6837.100
Protein function: A cytochrome P450 monooxygenase that catalyzes the biosynthesis of adrenal mineralocorticoid aldosterone (PubMed:11856349, PubMed:23322723, PubMed:1594605, PubMed:9814506). Catalyzes three sequential oxidative reactions of 11-deoxycorticosterone/21- hydroxyprogesterone, namely 11-beta hydroxylation...
| Keywords: | Anti-Cytochrome P450 11B2, Anti-mitochondrial, Anti-Aldosterone synthase, Anti-ALDOS, Anti-Aldosterone-synthesizing... |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human |
From 206.00€
*
CYP11B2 PrEST Antigen
Item number: ATA-APrEST96158.100
PrEST Antigen CYP11B2, Gene description: cytochrome P450 family 11 subfamily B member 2, Alternative Gene Names: ALDOS, CPN2, CYP11B, CYP11BL, P-450C18, P450aldo, Antigen sequence: WVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: A...
| Keywords: | ALDOS, CYPXIB2, Cytochrome P-450C18, Aldosterone synthase, Cytochrome P-450Aldo, Steroid 18-hydroxylase,... |
| Expressed in: | E.coli |
| Origin: | human |
265.00€
*
Anti-CYP11B2
Item number: CSB-PA006391LA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: CYP11B2. Antigen Species: Human
| Keywords: | Anti-ALDOS, Anti-CYPXIB2, Anti-Cytochrome P-450C18, Anti-Aldosterone synthase, Anti-Cytochrome P-450Aldo, Anti-Steroid... |
| Application: | ELISA, IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*