Crystallin Lambda 1 (CRYl1) Recombinant, Human

Crystallin Lambda 1 (CRYl1) Recombinant, Human
Item number Size Datasheet Manual SDS Delivery time Quantity Price
154219.10 10 µg - -

5 - 10 business days*

454.00€
154219.50 50 µg - -

5 - 10 business days*

679.00€
154219.100 100 µg - -

5 - 10 business days*

905.00€
154219.200 200 µg - -

5 - 10 business days*

1,080.00€
154219.500 500 µg - -

5 - 10 business days*

1,644.00€
 
Source:|Recombinant Human from E. coli||Purity:|>95%||Endotoxin:|1.0EU per 1ug (determined by the... more
Product information "Crystallin Lambda 1 (CRYl1) Recombinant, Human"
Source:, Recombinant Human from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: Q9Y2S2, Fragment: Met1~Gln319 (Accession No: Q9Y2S2), Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-MASSAAGCVV IVGSGVIGRS WAMLFASGGF QVKLYDIEQQ QIRNALENIR KEMKLLEQAG SLKGSLSVEE QLSLISGCPN IQEAVEGAMH IQECVPEDLE LKKKIFAQLD SIIDDRVILS SSTSCLMPSK LFAGLVHVKQ CIVAHPVNPP YYIPLVELVP HPETAPTTVD RTHALMKKIG QCPMRVQKEV AGFVLNRLQY AIISEAWRLV EEGIVSPSDL DLVMSEGLGM RYAFIGPLET MHLNAEGMLS YCDRYSEGIK HVLQTFGPIP EFSRATAEKV NQDMCMKVPD DPEHLAARRQ WRDECLMRLA KLKSQVQPQ, Epitope Tag: N-terminal Tags: His-tag and S-tag, Molecular Weight: 41.1kD, Applications: Suitable for use in ELISA, Western Blot, Immunoprecipitation, SDS-PAGE., Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -80°C. Aliquots are stable for at least 12 months from date of shipment. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Thermal stability is described by the loss rate of the target protein. The loss rate was determined by accelerated thermal degradation by incubating the protein at 37°C for 48h, with no obvious degradation or precipitation observed. Protein loss is <5% within the expiration date under appropriate storage conditions.
Supplier: United States Biological
Supplier-Nr: 154219

Properties

Conjugate: No
Format: Highly Purified

Database Information

UniProt ID : Q9Y2S2 | Matching products

Handling & Safety

Storage: vT
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Crystallin Lambda 1 (CRYl1) Recombinant, Human"
Write a review
or to review a product.
Viewed