- Search results for Q9Y2S2
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
20 products were found matching "Q9Y2S2"!
Close filters
Filter by:
No results were found for the filter!
Item number: ABS-KB-31847.100
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal. Identity-Mouse (%): 84%. Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 84%, Rat - 85%, Pig - 79%, Cynomolgus monkey - 98%. IHC Verification: -. WB Verification: -. IP Verification: -. IF...
| Keywords: | Anti-CRYL1, Anti-Lambda-crystallin homolog, Anti-L-gulonate 3-dehydrogenase, CRYL1 Antibody (Biotin) |
| Application: | ELISA |
| Host: | Mouse |
| Species reactivity: | human |
From 232.00€
*
Item number: ABS-KB-31632.100
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal. Identity-Mouse (%): 84%. Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 84%, Rat - 85%, Pig - 79%, Cynomolgus monkey - 98%. IHC Verification: -. WB Verification: -. IP Verification: -. IF...
| Keywords: | Anti-CRYL1, Anti-Lambda-crystallin homolog, Anti-L-gulonate 3-dehydrogenase, CRYL1 Antibody (Biotin) |
| Application: | ELISA |
| Host: | Mouse |
| Species reactivity: | human |
From 232.00€
*
Item number: ABS-KB-31763.100
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal. Identity-Mouse (%): 84%. Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 84%, Rat - 85%, Pig - 79%, Cynomolgus monkey - 98%. IHC Verification: -. WB Verification: -. IP Verification: -. IF...
| Keywords: | Anti-CRYL1, Anti-Lambda-crystallin homolog, Anti-L-gulonate 3-dehydrogenase, CRYL1 Antibody (Biotin) |
| Application: | ELISA |
| Host: | Mouse |
| Species reactivity: | human |
From 232.00€
*
Item number: ABS-KC-32969.100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide. Identity-Mouse (%): 84%. Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 84%, Rat - 85%, Pig - 79%, Cynomolgus monkey - 98%. IHC Verification: -. WB Verification: -. IP Verification: -....
| Keywords: | Anti-CRYL1, Anti-Lambda-crystallin homolog, Anti-L-gulonate 3-dehydrogenase, CRYL1 Antibody |
| Application: | ELISA |
| Host: | Mouse |
| Species reactivity: | human |
From 232.00€
*
Item number: ABS-ES-3180.1
Product Description: Crystallin lambda 1 (CRYL1) is an NAD(H)-dependent enzyme that catalyzes the dehydrogenation of L-gulonate to dehydro-L-gulonate in the uronate cycle, an alternative glucose metabolic pathway responsible for approximately 5% of daily glucose catabolism. The protein is widely expressed in various...
| Keywords: | Anti-CRYL1, Anti-Lambda-crystallin homolog, Anti-L-gulonate 3-dehydrogenase, Human CRYL1 Antibody Pair |
| Application: | ELISA |
| Host: | Mouse/Mouse |
| Species reactivity: | human |
1,080.00€
*
Item number: ABS-ES-3179.1
Product Description: Crystallin lambda 1 (CRYL1) is an NAD(H)-dependent enzyme that catalyzes the dehydrogenation of L-gulonate to dehydro-L-gulonate in the uronate cycle, an alternative glucose metabolic pathway responsible for approximately 5% of daily glucose catabolism. The protein is widely expressed in various...
| Keywords: | Anti-CRYL1, Anti-Lambda-crystallin homolog, Anti-L-gulonate 3-dehydrogenase, Human CRYL1 Antibody Pair |
| Application: | ELISA |
| Host: | Mouse/Mouse |
| Species reactivity: | human |
1,080.00€
*
Item number: ABS-ES-3178.1
Product Description: Crystallin lambda 1 (CRYL1) is an NAD(H)-dependent enzyme that catalyzes the dehydrogenation of L-gulonate to dehydro-L-gulonate in the uronate cycle, an alternative glucose metabolic pathway responsible for approximately 5% of daily glucose catabolism. The protein is widely expressed in various...
| Keywords: | Anti-CRYL1, Anti-Lambda-crystallin homolog, Anti-L-gulonate 3-dehydrogenase, Human CRYL1 Antibody Pair |
| Application: | ELISA |
| Host: | Mouse/Mouse |
| Species reactivity: | human |
1,080.00€
*
Item number: ATA-HPA040403.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 83% and to rat: 81%
| Keywords: | Anti-CRY, Anti-CRYL1, Anti-Gul3DH, EC=1.1.1.45, Anti-Lambda-crystallin homolog, Anti-L-gulonate 3-dehydrogenase |
| Application: | ICC, IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 246.00€
*
Item number: ELK-ELK5199.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Human CRYl1. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Human CRYl1. Next,...
| Keywords: | CRY, CRYL1, Gul3DH, Lambda-crystallin homolog, L-gulonate 3-dehydrogenase |
| Application: | ELISA |
| Species reactivity: | human |
From 374.00€
*
Item number: C7942-41A.200
Various biochemical, physiological and behavioral processes display circadian rhythms controlled by an internal biological clock. The central "gears" driving this clock appear to be composed of an autoregulatory transcription/posttranslation-based feedback loop. Cryptochrome 1 (CRY1) and 2 (CRY2) are DNA-binding...
| Keywords: | Anti-CRYL1, Anti-Gul3DH, EC=1.1.1.45, Anti-Lambda-crystallin homolog, Anti-L-gulonate 3-dehydrogenase |
| Application: | ELISA, IHC, WB |
| Host: | Rabbit |
| Species reactivity: | human |
865.00€
*
Item number: 154219.10
Source:, Recombinant Human from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: Q9Y2S2, Fragment: Met1~Gln319 (Accession No: Q9Y2S2), Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-MASSAAGCVV IVGSGVIGRS WAMLFASGGF QVKLYDIEQQ QIRNALENIR KEMKLLEQAG...
From 454.00€
*
Item number: 154220.10
Source:, Recombinant Human from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: Q9Y2S2, Fragment: Leu24~Tyr232 (Accession No: Q9Y2S2), Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-LFASGGF QVKLYDIEQQ QIRNALENIR KEMKLLEQAG SLKGSLSVEE QLSLISGCPN IQEAVEGAMH...
From 454.00€
*