20 products were found matching "Q9Y2S2"!

Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal. Identity-Mouse (%): 84%. Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 84%, Rat - 85%, Pig - 79%, Cynomolgus monkey - 98%. IHC Verification: -. WB Verification: -. IP Verification: -. IF...

Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal. Identity-Mouse (%): 84%. Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 84%, Rat - 85%, Pig - 79%, Cynomolgus monkey - 98%. IHC Verification: -. WB Verification: -. IP Verification: -. IF...

Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal. Identity-Mouse (%): 84%. Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 84%, Rat - 85%, Pig - 79%, Cynomolgus monkey - 98%. IHC Verification: -. WB Verification: -. IP Verification: -. IF...

Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide. Identity-Mouse (%): 84%. Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 84%, Rat - 85%, Pig - 79%, Cynomolgus monkey - 98%. IHC Verification: -. WB Verification: -. IP Verification: -....

Product Description: Crystallin lambda 1 (CRYL1) is an NAD(H)-dependent enzyme that catalyzes the dehydrogenation of L-gulonate to dehydro-L-gulonate in the uronate cycle, an alternative glucose metabolic pathway responsible for approximately 5% of daily glucose catabolism. The protein is widely expressed in various...

Product Description: Crystallin lambda 1 (CRYL1) is an NAD(H)-dependent enzyme that catalyzes the dehydrogenation of L-gulonate to dehydro-L-gulonate in the uronate cycle, an alternative glucose metabolic pathway responsible for approximately 5% of daily glucose catabolism. The protein is widely expressed in various...

Product Description: Crystallin lambda 1 (CRYL1) is an NAD(H)-dependent enzyme that catalyzes the dehydrogenation of L-gulonate to dehydro-L-gulonate in the uronate cycle, an alternative glucose metabolic pathway responsible for approximately 5% of daily glucose catabolism. The protein is widely expressed in various...

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 83% and to rat: 81%

The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Human CRYl1. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Human CRYl1. Next,...

Various biochemical, physiological and behavioral processes display circadian rhythms controlled by an internal biological clock. The central "gears" driving this clock appear to be composed of an autoregulatory transcription/posttranslation-based feedback loop. Cryptochrome 1 (CRY1) and 2 (CRY2) are DNA-binding...

Source:, Recombinant Human from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: Q9Y2S2, Fragment: Met1~Gln319 (Accession No: Q9Y2S2), Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-MASSAAGCVV IVGSGVIGRS WAMLFASGGF QVKLYDIEQQ QIRNALENIR KEMKLLEQAG...

Source:, Recombinant Human from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: Q9Y2S2, Fragment: Leu24~Tyr232 (Accession No: Q9Y2S2), Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-LFASGGF QVKLYDIEQQ QIRNALENIR KEMKLLEQAG SLKGSLSVEE QLSLISGCPN IQEAVEGAMH...