CDHR1 PrEST Antigen

CDHR1 PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST95578.100 100 µl

3 - 8 business days*

264.00€
 
PrEST Antigen CDHR1, Gene description: cadherin related family member 1, Alternative Gene Names:... more
Product information "CDHR1 PrEST Antigen"
PrEST Antigen CDHR1, Gene description: cadherin related family member 1, Alternative Gene Names: CORD15, KIAA1775, PCDH21, RP65, Antigen sequence: ATVPVTIRIVDLNNHPPTFYGESGPQNRFELSMNEHPPQGEILRGLKITVNDSDQGANAKFNLQLVGPRGIFRVVPQTVLNEAQVTIIVENSAAIDFEKSKVLTFKLLAVEVNTPEKFSSTADV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Potential calcium-dependent cell-adhesion protein. May be required for the structural integrity of the outer segment (OS) of photoreceptor cells. [The UniProt Consortium] Mouse gene identity: 94% Rat gene identity: 94%
Keywords: prCAD, KIAA1775, Protocadherin-21, Photoreceptor cadherin, Cadherin-related family member 1
Supplier: Atlas Antibodies
Supplier-Nr: APrEST95578

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "CDHR1 PrEST Antigen"
Write a review
or to review a product.
Viewed