- Search results for K16501
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
9 products were found matching "K16501"!
Close filters
Filter by:
No results were found for the filter!
Item number: ATA-HPA036819.100
Protein function: Potential calcium-dependent cell-adhesion protein. May be required for the structural integrity of the outer segment (OS) of photoreceptor cells. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse:...
| Keywords: | Anti-prCAD, Anti-KIAA1775, Anti-Protocadherin-21, Anti-Photoreceptor cadherin, Anti-Cadherin-related family member 1 |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 246.00€
*
Item number: ATA-HPA010795.100
Polyclonal Antibody against Human CDHR1, Gene description: cadherin related family member 1, Alternative Gene Names: CORD15, KIAA1775, PCDH21, RP65, Validated applications: ICC, Uniprot ID: Q96JP9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Potential...
| Keywords: | Anti-prCAD, Anti-KIAA1775, Anti-Protocadherin-21, Anti-Photoreceptor cadherin, Anti-Cadherin-related family member 1 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Item number: ATA-HPA010795.25
Polyclonal Antibody against Human CDHR1, Gene description: cadherin related family member 1, Alternative Gene Names: CORD15, KIAA1775, PCDH21, RP65, Validated applications: ICC, Uniprot ID: Q96JP9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Potential...
| Keywords: | Anti-prCAD, Anti-KIAA1775, Anti-Protocadherin-21, Anti-Photoreceptor cadherin, Anti-Cadherin-related family member 1 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
361.00€
*
Item number: CSB-PA731844XA01DIL.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Keywords: | Anti-prCAD, Anti-cdhr1, Anti-Protocadherin-21, Anti-Photoreceptor cadherin, Anti-Cadherin-related family member 1a, cdhr1... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | Danio rerio (Zebrafish) (Brachydanio rerio) |
1,529.00€
*
Item number: ATA-APrEST79641.100
Protein function: Potential calcium-dependent cell-adhesion protein. May be required for the structural integrity of the outer segment (OS) of photoreceptor cells. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | prCAD, KIAA1775, Protocadherin-21, Photoreceptor cadherin, Cadherin-related family member 1 |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: ABS-PQ-755.100
Protein function: Potential calcium-dependent cell-adhesion protein. May be required for the structural integrity of the outer segment (OS) of photoreceptor cells. [The UniProt Consortium]
| Keywords: | Cadherin-related family member 1, Photoreceptor cadherin, prCAD, Protocadherin-21, Recombinant Human CDHR1 Protein |
| Expressed in: | human cells |
| Origin: | human |
| MW: | 13.5 kD |
From 270.00€
*
Item number: ATA-APrEST95578.100
PrEST Antigen CDHR1, Gene description: cadherin related family member 1, Alternative Gene Names: CORD15, KIAA1775, PCDH21, RP65, Antigen sequence: ATVPVTIRIVDLNNHPPTFYGESGPQNRFELSMNEHPPQGEILRGLKITVNDSDQGANAKFNLQLVGPRGIFRVVPQTVLNEAQVTIIVENSAAIDFEKSKVLTFKLLAVEVNTPEKFSSTADV, Storage: Upon delivery store at -20°C. Avoid...
| Keywords: | prCAD, KIAA1775, Protocadherin-21, Photoreceptor cadherin, Cadherin-related family member 1 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: CSB-PA731844XA01DIL.2
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Keywords: | Anti-prCAD, Anti-cdhr1, Anti-Protocadherin-21, Anti-Photoreceptor cadherin, Anti-Cadherin-related family member 1a, cdhr1... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | Danio rerio (Zebrafish) (Brachydanio rerio) |
From 1,529.00€
*
Item number: ABS-PQ-755-L.100
Protein function: Potential calcium-dependent cell-adhesion protein. May be required for the structural integrity of the outer segment (OS) of photoreceptor cells. [The UniProt Consortium]
| Keywords: | Cadherin-related family member 1, Photoreceptor cadherin, prCAD, Protocadherin-21, Recombinant Human CDHR1 Protein |
| Expressed in: | human cells |
| Origin: | human |
| MW: | 13.5 kD |
From 295.00€
*