8 products were found matching "K16501"!
No results were found for the filter!
Anti-CDHR1
Item number: ATA-HPA036819.100
Protein function: Potential calcium-dependent cell-adhesion protein. May be required for the structural integrity of the outer segment (OS) of photoreceptor cells. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse:...
| Keywords: | Anti-prCAD, Anti-KIAA1775, Anti-Protocadherin-21, Anti-Photoreceptor cadherin, Anti-Cadherin-related family member 1 |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 246.00€
*
Anti-CDHR1
Item number: ATA-HPA010795.100
Polyclonal Antibody against Human CDHR1, Gene description: cadherin related family member 1, Alternative Gene Names: CORD15, KIAA1775, PCDH21, RP65, Validated applications: ICC, Uniprot ID: Q96JP9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Potential...
| Keywords: | Anti-prCAD, Anti-KIAA1775, Anti-Protocadherin-21, Anti-Photoreceptor cadherin, Anti-Cadherin-related family member 1 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
NEW
Anti-cdhr1
Item number: CSB-PA731844XA01DIL.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Keywords: | Anti-prCAD, Anti-cdhr1, Anti-Protocadherin-21, Anti-Photoreceptor cadherin, Anti-Cadherin-related family member 1a, cdhr1... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | Danio rerio (Zebrafish) (Brachydanio rerio) |
1,529.00€
*
CDHR1 (human), recombinant protein
Item number: ABS-PQ-755-L.100
Protein function: Potential calcium-dependent cell-adhesion protein. May be required for the structural integrity of the outer segment (OS) of photoreceptor cells. [The UniProt Consortium]
| Keywords: | Cadherin-related family member 1, Photoreceptor cadherin, prCAD, Protocadherin-21, Recombinant Human CDHR1 Protein |
| Expressed in: | human cells |
| Origin: | human |
| MW: | 13.5 kD |
From 295.00€
*
CDHR1 PrEST Antigen
Item number: ATA-APrEST79641.100
Protein function: Potential calcium-dependent cell-adhesion protein. May be required for the structural integrity of the outer segment (OS) of photoreceptor cells. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | prCAD, KIAA1775, Protocadherin-21, Photoreceptor cadherin, Cadherin-related family member 1 |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
CDHR1 (human), recombinant protein
Item number: ABS-PQ-755.100
Protein function: Potential calcium-dependent cell-adhesion protein. May be required for the structural integrity of the outer segment (OS) of photoreceptor cells. [The UniProt Consortium]
| Keywords: | Cadherin-related family member 1, Photoreceptor cadherin, prCAD, Protocadherin-21, Recombinant Human CDHR1 Protein |
| Expressed in: | human cells |
| Origin: | human |
| MW: | 13.5 kD |
From 270.00€
*
CDHR1 PrEST Antigen
Item number: ATA-APrEST95578.100
PrEST Antigen CDHR1, Gene description: cadherin related family member 1, Alternative Gene Names: CORD15, KIAA1775, PCDH21, RP65, Antigen sequence: ATVPVTIRIVDLNNHPPTFYGESGPQNRFELSMNEHPPQGEILRGLKITVNDSDQGANAKFNLQLVGPRGIFRVVPQTVLNEAQVTIIVENSAAIDFEKSKVLTFKLLAVEVNTPEKFSSTADV, Storage: Upon delivery store at -20°C. Avoid...
| Keywords: | prCAD, KIAA1775, Protocadherin-21, Photoreceptor cadherin, Cadherin-related family member 1 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Anti-cdhr1
Item number: CSB-PA731844XA01DIL.2
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Keywords: | Anti-prCAD, Anti-cdhr1, Anti-Protocadherin-21, Anti-Photoreceptor cadherin, Anti-Cadherin-related family member 1a, cdhr1... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | Danio rerio (Zebrafish) (Brachydanio rerio) |
From 1,529.00€
*