- Search results for P15812
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
16 products were found matching "P15812"!
Close filters
Filter by:
No results were found for the filter!
Item number: ATA-HPA070634.100
Polyclonal Antibody against Human CD1E, Gene description: CD1e molecule, Validated applications: ICC, Uniprot ID: P15812, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: T-cell surface glycoprotein CD1e, soluble binds diacetylated lipids, including...
Keywords: | Anti-CD1E |
Application: | ICC |
Host: | Rabbit |
Species reactivity: | human |
477.00€
*
Item number: CSB-PA001432.100
Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
Keywords: | Anti-CD1E, CD_antigen=CD1e antibody, CD1A antibody, CD1e antibody, CD1e antigen antibody, CD1E antigen, e polypeptide... |
Application: | ELISA, WB |
Host: | Rabbit |
Species reactivity: | human |
From 126.00€
*
Item number: CSB-PA005193.100
Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
Keywords: | Anti-CD1E, CD_antigen=CD1e antibody, CD1A antibody, CD1e antibody, CD1e antigen antibody, CD1E antigen, e polypeptide... |
Application: | ELISA, WB |
Host: | Rabbit |
Species reactivity: | human |
From 126.00€
*
Item number: CSB-PA912791.100
Host Species: Rabbit. Isotype: IgG. Buffer: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by...
Keywords: | Anti-CD1E, CD_antigen=CD1e antibody, CD1A antibody, CD1e antibody, CD1e antigen antibody, CD1E antigen, e polypeptide... |
Application: | ELISA, WB |
Host: | Rabbit |
Species reactivity: | human |
283.00€
*
Item number: NSJ-F52013-0.08ML
In 1X PBS, pH 7.4, with 0.09% sodium azide. CD1E encodes a member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and...
Keywords: | Anti-CD1E, CD1e Antibody |
Application: | WB, IHC, FC, IF, ELISA |
Host: | Rabbit |
Species reactivity: | human |
From 350.00€
*
Item number: ATA-HPA057769.100
Protein function: T-cell surface glycoprotein CD1e, soluble binds diacetylated lipids, including phosphatidyl inositides and diacylated sulfoglycolipids, and is required for the presentation of glycolipid antigens on the cell surface. The membrane-associated form is not active. [The UniProt Consortium] Buffer: 40%...
Keywords: | Anti-CD1E |
Application: | IHC, WB |
Host: | Rabbit |
Species reactivity: | human |
477.00€
*

Item number: ATA-APrEST96173.100
PrEST Antigen CD1E, Gene description: CD1e molecule, Antigen sequence: ISWEPSPGAGIRAQNICKVLNRYLDIKEILQSLLGHTCPRFLAGLMEAGESELKRKVKP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: T-cell surface glycoprotein CD1e, soluble binds diacetylated lipids, including phosphatidyl...
Keywords: | CD1E |
Expressed in: | E.coli |
Origin: | human |
265.00€
*

Item number: CSB-PA004893LB01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: CD1E. Antigen Species: Human
Keywords: | Anti-CD1E, CD_antigen=CD1e antibody, CD1A antibody, CD1e antibody, CD1e antigen antibody, CD1E antigen, e polypeptide... |
Application: | ELISA |
Host: | Rabbit |
Species reactivity: | human |
From 167.00€
*

Item number: CSB-PA004893LD01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: CD1E. Antigen Species: Human
Keywords: | Anti-CD1E, CD_antigen=CD1e antibody, CD1A antibody, CD1e antibody, CD1e antigen antibody, CD1E antigen, e polypeptide... |
Application: | ELISA |
Host: | Rabbit |
Species reactivity: | human |
From 167.00€
*

Item number: CSB-PA004893LA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: CD1E. Antigen Species: Human
Keywords: | Anti-CD1E, CD_antigen=CD1e antibody, CD1A antibody, CD1e antibody, CD1e antigen antibody, CD1E antigen, e polypeptide... |
Application: | ELISA, IHC |
Host: | Rabbit |
Species reactivity: | human |
From 167.00€
*

Item number: CSB-PA004893LC01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: CD1E. Antigen Species: Human
Keywords: | Anti-CD1E, CD_antigen=CD1e antibody, CD1A antibody, CD1e antibody, CD1e antigen antibody, CD1E antigen, e polypeptide... |
Host: | Rabbit |
Species reactivity: | human |
From 167.00€
*

Item number: VHPS-1669
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Keywords: | CD1e, CD1E, R2G1, hCD1e, sCD1e, T-cell surface glycoprotein CD1e, soluble, T-cell surface glycoprotein CD1e,... |
Application: | RNA quantification |
44.00€
*