16 products were found matching "P15812"!

1 from 2 pages
No results were found for the filter!
Anti-CD1E
Anti-CD1E

Item number: ATA-HPA070634.100

Polyclonal Antibody against Human CD1E, Gene description: CD1e molecule, Validated applications: ICC, Uniprot ID: P15812, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: T-cell surface glycoprotein CD1e, soluble binds diacetylated lipids, including...
Keywords: Anti-CD1E
Application: ICC
Host: Rabbit
Species reactivity: human
477.00€ *
Review
Anti-CD1E
Anti-CD1E

Item number: CSB-PA001432.100

Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
Keywords: Anti-CD1E, CD_antigen=CD1e antibody, CD1A antibody, CD1e antibody, CD1e antigen antibody, CD1E antigen, e polypeptide...
Application: ELISA, WB
Host: Rabbit
Species reactivity: human
From 126.00€ *
Review
Anti-CD1E
Anti-CD1E

Item number: CSB-PA005193.100

Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
Keywords: Anti-CD1E, CD_antigen=CD1e antibody, CD1A antibody, CD1e antibody, CD1e antigen antibody, CD1E antigen, e polypeptide...
Application: ELISA, WB
Host: Rabbit
Species reactivity: human
From 126.00€ *
Review
Anti-CD1E
Anti-CD1E

Item number: CSB-PA912791.100

Host Species: Rabbit. Isotype: IgG. Buffer: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by...
Keywords: Anti-CD1E, CD_antigen=CD1e antibody, CD1A antibody, CD1e antibody, CD1e antigen antibody, CD1E antigen, e polypeptide...
Application: ELISA, WB
Host: Rabbit
Species reactivity: human
283.00€ *
Review
Anti-CD1e
Anti-CD1e

Item number: NSJ-F52013-0.08ML

In 1X PBS, pH 7.4, with 0.09% sodium azide. CD1E encodes a member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and...
Keywords: Anti-CD1E, CD1e Antibody
Application: WB, IHC, FC, IF, ELISA
Host: Rabbit
Species reactivity: human
From 350.00€ *
Review
Anti-CD1E
Anti-CD1E

Item number: ATA-HPA057769.100

Protein function: T-cell surface glycoprotein CD1e, soluble binds diacetylated lipids, including phosphatidyl inositides and diacylated sulfoglycolipids, and is required for the presentation of glycolipid antigens on the cell surface. The membrane-associated form is not active. [The UniProt Consortium] Buffer: 40%...
Keywords: Anti-CD1E
Application: IHC, WB
Host: Rabbit
Species reactivity: human
477.00€ *
Review
CD1E PrEST Antigen
CD1E PrEST Antigen

Item number: ATA-APrEST96173.100

PrEST Antigen CD1E, Gene description: CD1e molecule, Antigen sequence: ISWEPSPGAGIRAQNICKVLNRYLDIKEILQSLLGHTCPRFLAGLMEAGESELKRKVKP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: T-cell surface glycoprotein CD1e, soluble binds diacetylated lipids, including phosphatidyl...
Keywords: CD1E
Expressed in: E.coli
Origin: human
265.00€ *
Review
Anti-CD1E, HRP conjugated
Anti-CD1E, HRP conjugated

Item number: CSB-PA004893LB01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: CD1E. Antigen Species: Human
Keywords: Anti-CD1E, CD_antigen=CD1e antibody, CD1A antibody, CD1e antibody, CD1e antigen antibody, CD1E antigen, e polypeptide...
Application: ELISA
Host: Rabbit
Species reactivity: human
From 167.00€ *
Review
Anti-CD1E, Biotin conjugated
Anti-CD1E, Biotin conjugated

Item number: CSB-PA004893LD01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: CD1E. Antigen Species: Human
Keywords: Anti-CD1E, CD_antigen=CD1e antibody, CD1A antibody, CD1e antibody, CD1e antigen antibody, CD1E antigen, e polypeptide...
Application: ELISA
Host: Rabbit
Species reactivity: human
From 167.00€ *
Review
Anti-CD1E
Anti-CD1E

Item number: CSB-PA004893LA01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: CD1E. Antigen Species: Human
Keywords: Anti-CD1E, CD_antigen=CD1e antibody, CD1A antibody, CD1e antibody, CD1e antigen antibody, CD1E antigen, e polypeptide...
Application: ELISA, IHC
Host: Rabbit
Species reactivity: human
From 167.00€ *
Review
Anti-CD1E, FITC conjugated
Anti-CD1E, FITC conjugated

Item number: CSB-PA004893LC01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: CD1E. Antigen Species: Human
Keywords: Anti-CD1E, CD_antigen=CD1e antibody, CD1A antibody, CD1e antibody, CD1e antigen antibody, CD1E antigen, e polypeptide...
Host: Rabbit
Species reactivity: human
From 167.00€ *
Review
CD1E, Human CD1e molecule, Real Time PCR Primer Set
CD1E, Human CD1e molecule, Real Time PCR Primer Set

Item number: VHPS-1669

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Keywords: CD1e, CD1E, R2G1, hCD1e, sCD1e, T-cell surface glycoprotein CD1e, soluble, T-cell surface glycoprotein CD1e,...
Application: RNA quantification
44.00€ *
Review
1 from 2 pages