Caspase 3 (CASP3) Recombinant, Rat

Caspase 3 (CASP3) Recombinant, Rat
Item number Size Datasheet Manual SDS Delivery time Quantity Price
153876.10 10 µg - -

5 - 10 business days*

520.00€
153876.50 50 µg - -

5 - 10 business days*

861.00€
153876.200 200 µg - -

5 - 10 business days*

1,244.00€
 
Source:|Recombinant Rat from E. coli||Purity:|>95%||Endotoxin:|1.0EU per 1ug (determined by the... more
Product information "Caspase 3 (CASP3) Recombinant, Rat"
Source:, Recombinant Rat from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: P55213, Fragment: Ser29~Asp175 (Accession No: P55213), Sequence: MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF-SG IYLDSSYKMD YPEMGLCIII NNKNFHKSTGMSARNGTDVD AANLRETFMA LKYEVRNKND LTREEIMELM DSVSKEDHSK RSSFVCVILS HGDEGVIFGT NGPVDLKKLT SFFRGDYCRS LTGKPKLFII QACRGTELDC GIETD, Epitope Tag: N-terminal Tags: His-tag and T7-tag, Molecular Weight: 20.3kD, Applications: Suitable for use in ELISA, Western Blot, Immunoprecipitation, SDS-PAGE., Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -80°C. Aliquots are stable for at least 12 months from date of shipment. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Thermal stability is described by the loss rate of the target protein. The loss rate was determined by accelerated thermal degradation by incubating the protein at 37°C for 48h, with no obvious degradation or precipitation observed. Protein loss is <5% within the expiration date under appropriate storage conditions.
Supplier: United States Biological
Supplier-Nr: 153876

Properties

Conjugate: No
Format: Highly Purified

Database Information

UniProt ID : P55213 | Matching products

Handling & Safety

Storage: vT
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Caspase 3 (CASP3) Recombinant, Rat"
Write a review
or to review a product.
Viewed