13 products were found matching "P55213"!

1 from 2 pages
No results were found for the filter!
Rat CASP3 (Caspase 3) ELISA Kit
Rat CASP3 (Caspase 3) ELISA Kit

Item number: ELK-ELK1528.96

The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Rat CASP3. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Rat CASP3. Next,...
Keywords: Cpp32, Casp3, EC=3.4.22.56
Application: ELISA
Species reactivity: rat
From 374.00€ *
Review
NEW
Rat CASP3 (Caspase 3) ELISA Kit
Rat CASP3 (Caspase 3) ELISA Kit

Item number: G-AEKE05846.96

The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Rat CASP3. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Rat CASP3. Next,...
Keywords: IRP, LICE, Casp3, Apopain, Caspase-3, Protein Yama, Cysteine protease CPP32, SREBP cleavage activity 1
Application: ELISA
Species reactivity: rat
694.00€ *
Review
NEW
Rat CASP3 (Caspase 3) ELISA (Small Sample Volume)
Rat CASP3 (Caspase 3) ELISA (Small Sample Volume)

Item number: G-AEKE05847.96

The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Rat CASP3. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Rat CASP3. Next,...
Keywords: IRP, LICE, Casp3, Apopain, Caspase-3, Protein Yama, Cysteine protease CPP32, SREBP cleavage activity 1
Application: ELISA
Species reactivity: rat
694.00€ *
Review
Rat Caspase 3, Casp-3 ELISA Kit
Rat Caspase 3, Casp-3 ELISA Kit

Item number: CSB-E08857r.48

Sample Types: serum, plasma, tissue homogenates Detection Range: 0.312 ng/mL-20 ng/mL Sensitivity: 0.078 ng/mL Assay Principle: quantitative Measurement: SandwichAssay Time: 1-5h Sample Volume: 50-100ulDetection Wavelength: 450 nmProtein function: Involved in the activation cascade of caspases responsible for...
Keywords: Cpp32, Casp3, EC=3.4.22.56
Application: ELISA, Sandwich ELISA
Species reactivity: rat
From 517.00€ *
Review
-10 %
Discount Promotion
Rat CASP3 (Caspase 3) ELISA Kit
Rat CASP3 (Caspase 3) ELISA Kit

Item number: E-EL-R0160.24

The kit is a Sandwich enzyme immunoassay for in vitro quantitative measurement of CASP3 in serum, plasma and other biological fluids. Detection Range: 0.31--20ng/mL. Sensitivity: 0.19ng/mL. Protein function: Involved in the activation cascade of caspases responsible for apoptosis execution. At the onset of apoptosis...
Keywords: Casp3, Cpp32, EC=3.4.22.56
Application: ELISA
Species reactivity: rat
122.00€ * From 109.80€ *
Review
Caspase 3 (CASP3) High Sensitivity BioAssay(TM) ELISA Kit (Rat)
Caspase 3 (CASP3) High Sensitivity BioAssay(TM) ELISA Kit...

Item number: 517075.96

Sample Type:, Serum, plasma, tissue homogenates, cell lysates and other biological fluids, Intended Use: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of CASP3 in rat serum, plasma, tissue homogenates, cell lysates and other biological fluids. Sensitivity: 5.3pg/ml, Range:...
Keywords: Casp3, Cpp32, EC=3.4.22.56
Application: ELISA
Species reactivity: rat
1,173.00€ *
Review
Caspase3 (Rat), His-Tag Recombinant
Caspase3 (Rat), His-Tag Recombinant

Item number: BPS-102292-1

Rat recombinant caspase3 protease, full length encompassing amino acids 1-277 (end). This construct contains a C-terminal His-tag (6xHis). The protein was affinity purified.
Keywords: Cpp32, Casp3, EC=3.4.22.56, Caspase3 (Rat) (1-277(end)-His)
Application: Enzyme kinetics, inhibitor screening, selectivity profiling
Expressed in: E.coli
Origin: rat
MW: 13/17 kD
From 189.00€ *
Review
Casp3, Rat caspase 3, apoptosis related cysteine protease, Real Time PCR Primer Set
Casp3, Rat caspase 3, apoptosis related cysteine...

Item number: VRPS-812

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Keywords: IRP, LICE, Casp3, Cpp32, SCA-1, CPP-32, CASP-3, Apopain, Caspase-3, EC=3.4.22.56, Protein Yama, Caspase-3 subunit p12,...
Application: RNA quantification
54.00€ *
Review
Caspase 3 (CASP3) Recombinant, Rat
Caspase 3 (CASP3) Recombinant, Rat

Item number: 153876.10

Source:, Recombinant Rat from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: P55213, Fragment: Ser29~Asp175 (Accession No: P55213), Sequence: MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF-SG IYLDSSYKMD YPEMGLCIII NNKNFHKSTGMSARNGTDVD AANLRETFMA LKYEVRNKND LTREEIMELM DSVSKEDHSK...
From 520.00€ *
Review
Caspase 3 (CASP3) Recombinant, Rat
Caspase 3 (CASP3) Recombinant, Rat

Item number: 153877.10

Source:, Recombinant Rat from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: P55213, Fragment: Ala183~His277 (Accession No: P55213), Sequence: MGSSHHHHHH SSGLVPRGSH MASMTGGQQM GRGS- ACQKIPVE ADFLYAYSTA PGYYSWRNSR DGSWFIQSLC AMLKLYAHKL EFMHILTRVN RKVATEFESF SLDATFHAKK...
From 477.00€ *
Review
Rat Caspase 3 ELISA Kit
Rat Caspase 3 ELISA Kit

Item number: G-RTFI00082.96

Application: ELISA
Species reactivity: rat
698.00€ *
Review
Rat CASP3 (Caspase 3) ELISA Kit
Rat CASP3 (Caspase 3) ELISA Kit

Item number: G-AEES00344.96

ELISA Type: Sandwich. Detection Range: 0.31-20µg/mL. Sensitivity: 0.19µg/mL. Sample Types: Serum, plasma and other biological fluids. Protein function: Involved in the activation cascade of caspases responsible for apoptosis execution. At the onset of apoptosis, it proteolytically cleaves poly(ADP-ribose) polymerase...
Keywords: Casp3, Cpp32, EC=3.4.22.56
Application: Sandwich
Species reactivity: rat
708.00€ *
Review
1 from 2 pages