13 products were found matching "P55213"!

The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Rat CASP3. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Rat CASP3. Next,...

The kit is a Sandwich enzyme immunoassay for in vitro quantitative measurement of CASP3 in serum, plasma and other biological fluids. Detection Range: 0.31--20ng/mL. Sensitivity: 0.19ng/mL. Protein function: Involved in the activation cascade of caspases responsible for apoptosis execution. At the onset of apoptosis...

Type: Sandwich. Detection Range: 62.5~4000pg/mL. Sensitivity: 37.5pg/mL. Tested Sample Types: Serum, Plasma, Cell supernatant. Test principle: This CLIA kit uses the Sandwich- CLIA principle. The micro CLIA plate provided in this kit has been pre-coated with an antibody specific to Rat CASP3 . Standards or samples...

Activity: Testing in progress Protein Construction: A DNA sequence encoding the Rat CASP3 protein (P55213) (Ser 29-Asp 175) was expressed with a N-His tag. Sequence: Ser 29-Asp 175. Fusion tag: N-His Endotoxin: Please contact us for more information. Apparent Molecular Mass: 20 kDa. Protein function: Involved in the...

Type: Sandwich. Detection Range: 62.5~4000pg/mL. Sensitivity: 37.5pg/mL. Tested Sample Types: Serum, Plasma, Cell supernatant. Test principle: This CLIA kit uses the Sandwich- CLIA principle. The micro CLIA plate provided in this kit has been pre-coated with an antibody specific to Rat CASP3 . Standards or samples...

The kit is a Sandwich enzyme immunoassay for in vitro quantitative measurement of CASP3 in serum, plasma and other biological fluids. Detection Range: 0.31--20ng/mL. Sensitivity: 0.19ng/mL. Protein function: Involved in the activation cascade of caspases responsible for apoptosis execution. At the onset of apoptosis...

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....

Source:, Recombinant Rat from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: P55213, Fragment: Ser29~Asp175 (Accession No: P55213), Sequence: MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF-SG IYLDSSYKMD YPEMGLCIII NNKNFHKSTGMSARNGTDVD AANLRETFMA LKYEVRNKND LTREEIMELM DSVSKEDHSK...

Source:, Recombinant Rat from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: P55213, Fragment: Ala183~His277 (Accession No: P55213), Sequence: MGSSHHHHHH SSGLVPRGSH MASMTGGQQM GRGS- ACQKIPVE ADFLYAYSTA PGYYSWRNSR DGSWFIQSLC AMLKLYAHKL EFMHILTRVN RKVATEFESF SLDATFHAKK...

Sample Type:, Serum, Plasma, Biological Fluids, Intended Use: This BioAssay(TM) kit is a sandwich ELISA for in vitro quantitative measurement of CASP3 in rat serum, plasma and other biological fluids, Sensitivity: 0.188ng/mL, Range: 0.313-20ng/mL, Specificity: Rat, Test Principle: This BioAssay(TM) ELISA kit uses...

Sample Type:, Serum, plasma, tissue homogenates, cell lysates and other biological fluids, Intended Use: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of CASP3 in rat serum, plasma, tissue homogenates, cell lysates and other biological fluids. Sensitivity: 5.3pg/ml, Range:...

ELISA Type: CLIA. Sensitivity: 37.5 pg/mL. Range: 62.5--4000 pg/mL. Protein function: Involved in the activation cascade of caspases responsible for apoptosis execution. At the onset of apoptosis it proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at a '216-Asp-, -Gly-217' bond. Cleaves and activates...