BRD4 (BD1+BD2), Recombinant, Human, aa49-460 (Bromodomain Containing 4, HUNK1, MCAP)

BRD4 (BD1+BD2), Recombinant, Human, aa49-460 (Bromodomain Containing 4, HUNK1, MCAP)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
298361.100 100 µg - -

3 - 19 business days*

937.00€
 
The protein encoded by this gene is homologous to the murine protein MCAP, which associates with... more
Product information "BRD4 (BD1+BD2), Recombinant, Human, aa49-460 (Bromodomain Containing 4, HUNK1, MCAP)"
The protein encoded by this gene is homologous to the murine protein MCAP, which associates with chromosomes during mitosis, and to the human RING3 protein, a serine/threonine kinase., Each of these proteins contains two bromodomains, a conserved sequence motif which may be involved in chromatin targeting. This gene has been implicated as the chromosome 19 target of translocation t(15,19)(q13,p13.1), which defines an upper respiratory tract carcinoma in young people. Two alternatively spliced transcript variants have been described. [provided by RefSeq, Jul 2008]. Source: Recombinant protein corresponding to aa49-460 from human Bromodomain containing 4, corresponding to bromodomains 1 and 2, expressed in E. coli. Molecular Weight: ~46.9kD, AA Sequence: GPLGSETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYK, IIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFL, QKINELPTEETEIMIVQAKGRGRGRKETGTAKPGVSTVPNTTQASTPPQTQTPQPNPP, PVQATPHPFPAVTPDLIVQTPVMTVVPPQPLQTPPPVPPQPQPPPAPAPQPVQSHPPII, AATPQPVKTKKGVKRKADTTTPTTIDPIHEPPSLPPEPKTTKLGQRRESSRPVKPPKK, DVPDSQQHPAPEKSSKVSEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHD, YCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKL, QDVFEMRFAKMPDE, Applications: Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. Aliquots are stable for 6 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Keywords: BRD4, HUNK1, Protein HUNK1, Bromodomain-containing protein 4
Supplier: United States Biological
Supplier-Nr: 298361

Properties

Conjugate: No
MW: 46,9
Format: Purified

Handling & Safety

Storage: -80°C
Shipping: -80°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "BRD4 (BD1+BD2), Recombinant, Human, aa49-460 (Bromodomain Containing 4, HUNK1, MCAP)"
Write a review
or to review a product.
Viewed