3 products were found matching "P59827"!
No results were found for the filter!
Anti-BPIFB4
Item number: ATA-HPA047388.100
Polyclonal Antibody against Human BPIFB4, Gene description: BPI fold containing family B member 4, Alternative Gene Names: C20orf186, dJ726C3.5, LPLUNC4, Validated applications: ICC, Uniprot ID: P59827, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May...
| Keywords: | Anti-BPIFB4, Anti-C20orf186, Anti-Ligand-binding protein RY2G5, Anti-BPI fold-containing family B member 4, Anti-Long... |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Human Long palate, lung and nasal epithelium...
Item number: CSB-EL003694HU.48
Sample Types: serum, plasma, tissue homogenates Detection Range: 25 pg/mL-1600 pg/mL Sensitivity: 6.25 pg/mL Assay Principle: quantitative Measurement: SandwichAssay Time: 1-5h Sample Volume: 50-100ulDetection Wavelength: 450 nmProtein function: May have the capacity to recognize and bind specific classes of...
| Keywords: | BPIFB4, C20orf186, Ligand-binding protein RY2G5, BPI fold-containing family B member 4, Long palate, lung and nasal... |
| Application: | ELISA, Sandwich ELISA |
| Species reactivity: | human |
From 581.00€
*
BPIFB4 PrEST Antigen
Item number: ATA-APrEST95860.100
PrEST Antigen BPIFB4, Gene description: BPI fold containing family B member 4, Alternative Gene Names: C20orf186, dJ726C3.5, LPLUNC4, Antigen sequence: PKDLETTICLIDVDTELLASFSIEGDKLMIDAKLEKTSLNLRTSNVGNFDIGLMEVLVEKIFDLAFMPAMNAVLG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein...
| Keywords: | BPIFB4, C20orf186, Ligand-binding protein RY2G5, BPI fold-containing family B member 4, Long palate, lung and nasal... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
