ATAD2B, Recombinant, Human, aa953-1080, GST-tag (KIAA1240, AAA Domain Containing 2B, Variant 1)

ATAD2B, Recombinant, Human, aa953-1080, GST-tag (KIAA1240, AAA Domain Containing 2B, Variant 1)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
298328.100 100 µg - -

3 - 19 business days*

937.00€
 
The protein encoded by this gene belongs to the AAA ATPase family. This family member includes an... more
Product information "ATAD2B, Recombinant, Human, aa953-1080, GST-tag (KIAA1240, AAA Domain Containing 2B, Variant 1)"
The protein encoded by this gene belongs to the AAA ATPase family. This family member includes an N-terminal bromodomain. It has been found to be localized to the nucleus, partly to replication sites, consistent with a chromatin-related function. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jul 2014], Source: Recombinant protein corresponding to aa953-1080 from bromodomain human ATAD2B, fused to GST-tag at N-terminal, expressed in E. coli. Molecular Weight: ~42kD, AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYI, DGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLK, VDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLV, CFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSEDQEE, NTLRELRLFLRDVTKRLATDKRFNIFSKPVDIEEVSDYLEVIKEPMDLSTVITKIDKHNYL, TAKDFLKDIDLICSNALEYNPDKDPGDKIIRHRACTLKDTAHAIIAAELDPEFNKLCEEIK, E, Applications: Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Keywords: ATAD2B, KIAA1240, ATPase family AAA domain-containing protein 2B
Supplier: United States Biological
Supplier-Nr: 298328

Properties

Conjugate: No
MW: 42
Format: Highly Purified

Handling & Safety

Storage: -80°C
Shipping: -80°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "ATAD2B, Recombinant, Human, aa953-1080, GST-tag (KIAA1240, AAA Domain Containing 2B, Variant 1)"
Write a review
or to review a product.
Viewed