Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
| Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
|---|---|---|---|---|---|---|---|
| ATA-APrEST95867.100 | 100 µl |
7 - 10 business days* |
264.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
PrEST Antigen ASAP2, Gene description: ArfGAP with SH3 domain, ankyrin repeat and PH domain 2,... more
Product information "ASAP2 PrEST Antigen"
PrEST Antigen ASAP2, Gene description: ArfGAP with SH3 domain, ankyrin repeat and PH domain 2, Alternative Gene Names: CENTB3, DDEF2, KIAA0400, PAP, SHAG1, Antigen sequence: WRLLHEDLDESDDDMDEKLQPSPNRREDRPISFYQLGSNQLQSNAVSLARDAANLAKDKQRAFMPSILQNETY, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Activates the small GTPases ARF1, ARF5 and ARF6. Regulates the formation of post-Golgi vesicles and modulates constitutive secretion. Modulates phagocytosis mediated by Fc gamma receptor and ARF6. Modulates PXN recruitment to focal contacts and cell migration. [The UniProt Consortium] Mouse gene identity: 89% Rat gene identity: 89%
| Keywords: | PAP, PAG3, ASAP2, DDEF2, Pyk2 C-terminus-associated protein, Development and differentiation-enhancing factor 2, Paxillin-associated protein with ARF GAP activity 3, Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2 |
| Supplier: | Atlas Antibodies |
| Supplier-Nr: | APrEST95867 |
Properties
| Conjugate: | No |
| Host: | E.coli |
| Species reactivity: | human |
| Format: | Solution |
Database Information
| KEGG ID : | K12488 | Matching products |
| UniProt ID : | O43150 | Matching products |
| Gene ID : | GeneID 8853 | Matching products |
Handling & Safety
| Storage: | -20°C (avoid repeat freezing and thawing cycles) |
| Shipping: | +4°C (International: °C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed