- Search results for O43150
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
10 products were found matching "O43150"!
Close filters
Filter by:
No results were found for the filter!
Item number: A303-311A
Protein function: Activates the small GTPases ARF1, ARF5 and ARF6. Regulates the formation of post-Golgi vesicles and modulates constitutive secretion. Modulates phagocytosis mediated by Fc gamma receptor and ARF6. Modulates PXN recruitment to focal contacts and cell migration. [The UniProt Consortium]
| Keywords: | Anti-PAP, Anti-PAG3, Anti-ASAP2, Anti-DDEF2, Anti-Pyk2 C-terminus-associated protein, Anti-Development and... |
| Application: | WB, IP |
| Host: | Rabbit |
| Species reactivity: | human |
From 165.00€
*
Item number: ATA-HPA068383.100
Polyclonal Antibody against Human ASAP2, Gene description: ArfGAP with SH3 domain, ankyrin repeat and PH domain 2, Alternative Gene Names: CENTB3, DDEF2, KIAA0400, PAP, SHAG1, Validated applications: ICC, Uniprot ID: O43150, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C....
| Keywords: | Anti-PAP, Anti-PAG3, Anti-DDEF2, Anti-ASAP2, Anti-Pyk2 C-terminus-associated protein, Anti-Development and... |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Item number: ABS-PP-4632-L.100
Protein function: Activates the small GTPases ARF1, ARF5 and ARF6. Regulates the formation of post-Golgi vesicles and modulates constitutive secretion. Modulates phagocytosis mediated by Fc gamma receptor and ARF6. Modulates PXN recruitment to focal contacts and cell migration. [The UniProt Consortium]
| Keywords: | Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2, Development and differentiation-enhancing factor... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 46.5 kD |
From 115.00€
*
Item number: VHPS-2497
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Keywords: | PAP, PAG3, DDEF2, ASAP2, Pyk2 C-terminus-associated protein, Development and differentiation-enhancing factor 2,... |
| Application: | RNA quantification |
45.00€
*
Item number: A3334-96.100
ASAP2 is a multidomain protein belonging to the beta family with two ANK repeats, an Arf-GAP domain, a PH domain and a SH3 domain. This protein localizes in the Golgi apparatus and also at the plasma membrane where it colocalizes with protein tyrosine kinase 2-beta (PYK2) and forms a stable complex with PYK2 in...
| Keywords: | Anti-Pyk2 C-terminus-associated protein, Anti-Development and differentiation-enhancing factor 2, Anti-Paxillin-associated... |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
667.00€
*
Item number: ELK-ES8991.100
This gene encodes a multidomain protein containing an N-terminal alpha-helical region with a coiled-coil motif, followed by a pleckstrin homology (PH) domain, an Arf-GAP domain, an ankyrin homology region, a proline-rich region, and a C-terminal Src homology 3 (SH3) domain. The protein localizes in the Golgi...
| Keywords: | Anti-PAP, Anti-PAG3, Anti-DDEF2, Anti-ASAP2, Anti-Pyk2 C-terminus-associated protein, Anti-Development and... |
| Application: | WB, ELISA |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
From 173.00€
*
Item number: CSB-CL002176HU.10
Length: 2886 Sequence: atgccggacc agatctccgt gtcggaattc gtggccgaga cccatgagga ctacaaggcg cccacggcct ccagcttcac cacccgcacg gcgcagtgcc ggaacactgt ggcggccatc gaggaggctt tggacgtgga ccggatggtt ctttacaaaa tgaagaaatc cgtgaaagca atcaacagct ctgggctggc tcacgtggaa aatgaagagc agtacaccca ggctctggag aagtttggcg gcaaccgtgt...
| Keywords: | PAP, PAG3, ASAP2, DDEF2, Pyk2 C-terminus-associated protein, Development and differentiation-enhancing factor 2,... |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
1,044.00€
*
Item number: ABS-PP-4632.100
Protein function: Activates the small GTPases ARF1, ARF5 and ARF6. Regulates the formation of post-Golgi vesicles and modulates constitutive secretion. Modulates phagocytosis mediated by Fc gamma receptor and ARF6. Modulates PXN recruitment to focal contacts and cell migration. [The UniProt Consortium]
| Keywords: | Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2, Development and differentiation-enhancing factor... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 46.5 kD |
From 90.00€
*
Item number: ATA-APrEST95867.100
PrEST Antigen ASAP2, Gene description: ArfGAP with SH3 domain, ankyrin repeat and PH domain 2, Alternative Gene Names: CENTB3, DDEF2, KIAA0400, PAP, SHAG1, Antigen sequence: WRLLHEDLDESDDDMDEKLQPSPNRREDRPISFYQLGSNQLQSNAVSLARDAANLAKDKQRAFMPSILQNETY, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw...
| Keywords: | PAP, PAG3, ASAP2, DDEF2, Pyk2 C-terminus-associated protein, Development and differentiation-enhancing factor 2,... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*