9 products were found matching "O43150"!

No results were found for the filter!
Anti-ASAP2
Anti-ASAP2

Item number: A303-311A

Protein function: Activates the small GTPases ARF1, ARF5 and ARF6. Regulates the formation of post-Golgi vesicles and modulates constitutive secretion. Modulates phagocytosis mediated by Fc gamma receptor and ARF6. Modulates PXN recruitment to focal contacts and cell migration. [The UniProt Consortium]
Keywords: Anti-PAP, Anti-PAG3, Anti-ASAP2, Anti-DDEF2, Anti-Pyk2 C-terminus-associated protein, Anti-Development and...
Application: WB, IP
Host: Rabbit
Species reactivity: human
From 165.00€ *
Review
Anti-ASAP2
Anti-ASAP2

Item number: ATA-HPA068383.100

Polyclonal Antibody against Human ASAP2, Gene description: ArfGAP with SH3 domain, ankyrin repeat and PH domain 2, Alternative Gene Names: CENTB3, DDEF2, KIAA0400, PAP, SHAG1, Validated applications: ICC, Uniprot ID: O43150, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C....
Keywords: Anti-PAP, Anti-PAG3, Anti-DDEF2, Anti-ASAP2, Anti-Pyk2 C-terminus-associated protein, Anti-Development and...
Application: ICC
Host: Rabbit
Species reactivity: human
491.00€ *
Review
ASAP2 (human), recombinant protein
ASAP2 (human), recombinant protein

Item number: ABS-PP-4632-L.100

Protein function: Activates the small GTPases ARF1, ARF5 and ARF6. Regulates the formation of post-Golgi vesicles and modulates constitutive secretion. Modulates phagocytosis mediated by Fc gamma receptor and ARF6. Modulates PXN recruitment to focal contacts and cell migration. [The UniProt Consortium]
Keywords: Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2, Development and differentiation-enhancing factor...
Expressed in: E.coli
Origin: human
MW: 46.5 kD
From 115.00€ *
Review
DDEF2, Human, Real Time PCR Primer Set
DDEF2, Human, Real Time PCR Primer Set

Item number: VHPS-2497

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Keywords: PAP, PAG3, DDEF2, ASAP2, Pyk2 C-terminus-associated protein, Development and differentiation-enhancing factor 2,...
Application: RNA quantification
45.00€ *
Review
Anti-ASAP2 (Arf-GAP with SH3 Domain, ANK Repeat and PH Domain-containing Protein 2, Development and
Anti-ASAP2 (Arf-GAP with SH3 Domain, ANK Repeat and PH...

Item number: A3334-96.100

ASAP2 is a multidomain protein belonging to the beta family with two ANK repeats, an Arf-GAP domain, a PH domain and a SH3 domain. This protein localizes in the Golgi apparatus and also at the plasma membrane where it colocalizes with protein tyrosine kinase 2-beta (PYK2) and forms a stable complex with PYK2 in...
Keywords: Anti-Pyk2 C-terminus-associated protein, Anti-Development and differentiation-enhancing factor 2, Anti-Paxillin-associated...
Application: WB
Host: Rabbit
Species reactivity: human, mouse, rat
667.00€ *
Review
Anti-ASAP2
Anti-ASAP2

Item number: ELK-ES8991.100

This gene encodes a multidomain protein containing an N-terminal alpha-helical region with a coiled-coil motif, followed by a pleckstrin homology (PH) domain, an Arf-GAP domain, an ankyrin homology region, a proline-rich region, and a C-terminal Src homology 3 (SH3) domain. The protein localizes in the Golgi...
Keywords: Anti-PAP, Anti-PAG3, Anti-DDEF2, Anti-ASAP2, Anti-Pyk2 C-terminus-associated protein, Anti-Development and...
Application: WB, ELISA
Host: Rabbit
Species reactivity: human, mouse
From 173.00€ *
Review
ASAP2 (Vector pUC, Accession No. BC063308)
ASAP2 (Vector pUC, Accession No. BC063308)

Item number: CSB-CL002176HU.10

Length: 2886 Sequence: atgccggacc agatctccgt gtcggaattc gtggccgaga cccatgagga ctacaaggcg cccacggcct ccagcttcac cacccgcacg gcgcagtgcc ggaacactgt ggcggccatc gaggaggctt tggacgtgga ccggatggtt ctttacaaaa tgaagaaatc cgtgaaagca atcaacagct ctgggctggc tcacgtggaa aatgaagagc agtacaccca ggctctggag aagtttggcg gcaaccgtgt...
Keywords: PAP, PAG3, ASAP2, DDEF2, Pyk2 C-terminus-associated protein, Development and differentiation-enhancing factor 2,...
Application: Molecular biology, clone
Species reactivity: human
1,044.00€ *
Review
ASAP2 (human), recombinant protein
ASAP2 (human), recombinant protein

Item number: ABS-PP-4632.100

Protein function: Activates the small GTPases ARF1, ARF5 and ARF6. Regulates the formation of post-Golgi vesicles and modulates constitutive secretion. Modulates phagocytosis mediated by Fc gamma receptor and ARF6. Modulates PXN recruitment to focal contacts and cell migration. [The UniProt Consortium]
Keywords: Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2, Development and differentiation-enhancing factor...
Expressed in: E.coli
Origin: human
MW: 46.5 kD
From 90.00€ *
Review
ASAP2 PrEST Antigen
ASAP2 PrEST Antigen

Item number: ATA-APrEST95867.100

PrEST Antigen ASAP2, Gene description: ArfGAP with SH3 domain, ankyrin repeat and PH domain 2, Alternative Gene Names: CENTB3, DDEF2, KIAA0400, PAP, SHAG1, Antigen sequence: WRLLHEDLDESDDDMDEKLQPSPNRREDRPISFYQLGSNQLQSNAVSLARDAANLAKDKQRAFMPSILQNETY, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw...
Keywords: PAP, PAG3, ASAP2, DDEF2, Pyk2 C-terminus-associated protein, Development and differentiation-enhancing factor 2,...
Expressed in: E.coli
Origin: human
264.00€ *
Review