Annexin A1 (ANXA1) Recombinant, Rat

Source:, Recombinant Rat from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: P07150, Fragment: Met1~Asn346 (Accession No: P07150), Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGS-MAMVSEFLKQ ACYIEKQEQE YVQAVKSYKG GPGSAVSPYP SFNPSSDVAA LHKAIMVKGV DEATIIDILT KRTNAQRQQI KAAYLQETGK PLDETLKKAL TGHLEEVVLA MLKTPAQFDA DELRAAMKGL GTDEDTLIEI LTTRSNQQIR EITRVYREEL KRDLAKDITS DTSGDFRNAL LALAKGDRCE DMSVNQDLAD TDARALYEAG ERRKGTDVNV FNTILTTRSY PHLRKVFQNY RKYSQHDMNK ALDLELKGDI EKCLTTIVKC ATSTPAFFAE KLYEAMKGAG TRHKTLIRIM VSRSEIDMNE IKVFYQKKYG IPLCQAILDE TKGDYEKILV ALCGGN, Epitope Tag: N-terminal Tags: His-tag and S-tag, Molecular Weight: 44.3kD, Applications: Suitable for use in ELISA, Western Blot, Immunoprecipitation, SDS-PAGE., Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -80°C. Aliquots are stable for at least 12 months from date of shipment. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Thermal stability is described by the loss rate of the target protein. The loss rate was determined by accelerated thermal degradation by incubating the protein at 37°C for 48h, with no obvious degradation or precipitation observed. Protein loss is <5% within the expiration date under appropriate storage conditions.