Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
Close filters
Filter by:
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
from to

Proteins and Enzymes

Proteins are found in every cell and form the basis of all biological processes. As molecular tools, they perform countless vital tasks in the body, for example by transporting metabolites, catalyzing chemical reactions, enabling cell movement or regulating gene expression. We offer a wide range of protein products, including enzymes, recombinant proteins and hormones. These products support researchers in molecular biology, cell biology, biochemistry and other scientific fields and can be used in a variety of applications, such as enzymatic assays, Western blots or protein-protein interaction studies.

Proteins are found in every cell and form the basis of all biological processes. As molecular tools, they perform countless vital tasks in the body, for example by transporting metabolites,... read more »
Close window
Proteins and Enzymes

Proteins are found in every cell and form the basis of all biological processes. As molecular tools, they perform countless vital tasks in the body, for example by transporting metabolites, catalyzing chemical reactions, enabling cell movement or regulating gene expression. We offer a wide range of protein products, including enzymes, recombinant proteins and hormones. These products support researchers in molecular biology, cell biology, biochemistry and other scientific fields and can be used in a variety of applications, such as enzymatic assays, Western blots or protein-protein interaction studies.

Filter
10873 from 10992 pages
No results were found for the filter!
VSIG4 PrEST Antigen
VSIG4 PrEST Antigen

Item number: ATA-APrEST95980.100

Atlas Antibodies
PrEST Antigen VSIG4, Gene description: V-set and immunoglobulin domain containing 4, Alternative Gene Names: CRIg, Z39IG, Antigen sequence: KGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein...
Keywords: CRIg, VSIG4, Protein Z39Ig, V-set and immunoglobulin domain-containing protein 4
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
CBX1 PrEST Antigen
CBX1 PrEST Antigen

Item number: ATA-APrEST95981.100

Atlas Antibodies
PrEST Antigen CBX1, Gene description: chromobox 1, Alternative Gene Names: CBX, HP1-BETA, HP1Hs-beta, M31, MOD1, Antigen sequence: ERLTWHSYPSEDDDKKDDKN, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Component of heterochromatin. Recognizes and binds histone H3 tails...
Keywords: M31, CBX, CBX1, p25beta, HP1 beta, HP1Hsbeta, Modifier 1 protein, Chromobox protein homolog 1, Heterochromatin protein...
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
GPR174 PrEST Antigen
GPR174 PrEST Antigen

Item number: ATA-APrEST95986.100

Atlas Antibodies
PrEST Antigen GPR174, Gene description: G protein-coupled receptor 174, Alternative Gene Names: FKSG79, Antigen sequence: LSLQDKYPMAQDLGEKQKALKM, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Putative receptor for purines coupled to G-proteins. [The UniProt Consortium]...
Keywords: FKSG79, GPR174, Probable G-protein coupled receptor 174
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
RIT2 PrEST Antigen
RIT2 PrEST Antigen

Item number: ATA-APrEST95990.100

Atlas Antibodies
PrEST Antigen RIT2, Gene description: Ras like without CAAX 2, Alternative Gene Names: RIBA, RIN, Antigen sequence: LVREIRKKESMPSLMEKKLKRKDSLWKKLKGSLKKKR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Binds and exchanges GTP and GDP. Binds and modulates the activation of...
Keywords: RIN, RIT2, GTP-binding protein Rit2, Ras-like without CAAX protein 2, Ras-like protein expressed in neurons
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
TEX13C PrEST Antigen
TEX13C PrEST Antigen

Item number: ATA-APrEST95991.100

Atlas Antibodies
PrEST Antigen TEX13C, Gene description: TEX13 family member C, Antigen sequence: ESAAAIAPQMPPAGIYPPGLWATVGSQEETAPPWDQKCHGQDGYPENFQGVYHPGDNRSCNQKEGSECPQGMTSQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 39% Rat gene identity: 39%
Keywords: Putative testis-expressed protein 13C
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
TIAL1 PrEST Antigen
TIAL1 PrEST Antigen

Item number: ATA-APrEST95996.100

Atlas Antibodies
PrEST Antigen TIAL1, Gene description: TIA1 cytotoxic granule associated RNA binding protein like 1, Alternative Gene Names: TIAR, Antigen sequence: SPDMTKNFQQVDYSQWGQWSQVYGNPQQYGQYMANGW, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: RNA-binding protein. Possesses...
Keywords: TIAL1, Nucleolysin TIAR, TIA-1-related protein
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
CCNY PrEST Antigen
CCNY PrEST Antigen

Item number: ATA-APrEST96001.100

Atlas Antibodies
PrEST Antigen CCNY, Gene description: cyclin Y, Alternative Gene Names: C10orf9, CBCP1, CFP1, Antigen sequence: DKYKDLRRSARKRSASADNLTLPRW, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Positive regulatory subunit of the cyclin-dependent kinases CDK14/PFTK1 and CDK16....
Keywords: CCNY, Cyc-Y, C10orf9, Cyclin-Y, cyclin-X, Cyclin box protein 1, Cyclin fold protein 1
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
TIGD6 PrEST Antigen
TIGD6 PrEST Antigen

Item number: ATA-APrEST96010.100

Atlas Antibodies
PrEST Antigen TIGD6, Gene description: tigger transposable element derived 6, Alternative Gene Names: DKFZp761E2110, Antigen sequence: MANKGNKKRRQFSLEEKMKVVGAVDSGKRKGDVAKEFGITPSTLSTFLKDRTKFEEKVREASVGPQRKRMRSALYDDIDKAVFAWFQEIHAK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene...
Keywords: TIGD6, Tigger transposable element-derived protein 6
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
TICAM1 PrEST Antigen
TICAM1 PrEST Antigen

Item number: ATA-APrEST96014.100

Atlas Antibodies
PrEST Antigen TICAM1, Gene description: TIR domain containing adaptor molecule 1, Alternative Gene Names: MGC35334, PRVTIRB, TICAM-1, TRIF, Antigen sequence: RLDKHSQIFARKVANTFKPHRLQARKAMWRKEQDTRALREQSQHLDGERMQAAALNAAYSAYLQSYLSYQAQMEQLQVAFGSHMSFGTGAPYGARM, Storage: Upon delivery store at -20°C. Avoid repeated...
Keywords: TICAM1, PRVTIRB, MyD88-3, TICAM-1, TIR domain-containing adapter molecule 1, Putative NF-kappa-B-activating protein 502H,...
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
TESPA1 PrEST Antigen
TESPA1 PrEST Antigen

Item number: ATA-APrEST96016.100

Atlas Antibodies
PrEST Antigen TESPA1, Gene description: thymocyte expressed, positive selection associated 1, Alternative Gene Names: ITPRID3, KIAA0748, Antigen sequence: GTNKTSSSISEILDKVQEDAEDVLFSLGFGQEDHKDTSRIPARFFTTPSQAKGIDFQLFLKSQVRRIEMEDPCLMLASRFKQVQTLAVT, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw...
Keywords: TESPA1, HSPC257, KIAA0748, Protein TESPA1, Thymocyte-expressed positive selection-associated protein 1
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
CCDC22 PrEST Antigen
CCDC22 PrEST Antigen

Item number: ATA-APrEST96021.100

Atlas Antibodies
PrEST Antigen CCDC22, Gene description: coiled-coil domain containing 22, Alternative Gene Names: CXorf37, JM1, Antigen sequence: KTGAPKGSRFTHSEKFTFHLEPQAQATQVSDVPATSRRPEQVTWAAQEQELESLREQLEGVNRSIEEVEADMKTLGVSFVQAESECRHSKLSTA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function:...
Keywords: JM1, CCDC22, CXorf37, Coiled-coil domain-containing protein 22
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
PTF1A PrEST Antigen
PTF1A PrEST Antigen

Item number: ATA-APrEST96027.100

Atlas Antibodies
PrEST Antigen PTF1A, Gene description: pancreas associated transcription factor 1a, Alternative Gene Names: bHLHa29, p48, PTF1-p48, Antigen sequence: LLEHFPGGLDAFPSSYFDEDDFFTDQSSRDPLEDGDELLADEQAEVEFLSHQLHEYCYR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Transcription...
Keywords: PTF1A, bHLHa29, BHLHA29, PTF1-p48, bHLH transcription factor p48, Class A basic helix-loop-helix protein 29,...
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
10873 from 10992 pages
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the usability of this website, serve for direct advertising or simplify interaction with other websites and social networks, will only be used with your consent. More information
Decline Accept all Configure