TESPA1 PrEST Antigen

PrEST Antigen TESPA1, Gene description: thymocyte expressed, positive selection associated 1, Alternative Gene Names: ITPRID3, KIAA0748, Antigen sequence: GTNKTSSSISEILDKVQEDAEDVLFSLGFGQEDHKDTSRIPARFFTTPSQAKGIDFQLFLKSQVRRIEMEDPCLMLASRFKQVQTLAVT, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Required for the development and maturation of T-cells, its function being essential for the late stages of thymocyte development. Plays a role in T-cell antigen receptor (TCR)-mediated activation of the ERK and NFAT signaling pathways, possibly by serving as a scaffolding protein that promotes the assembly of the LAT signalosome in thymocytes. May play a role in the regulation of inositol 1,4,5-trisphosphate receptor-mediated Ca(2+) release and mitochondrial Ca(2+) uptake via the mitochondria-associated endoplasmic reticulum membrane (MAM) compartment. [The UniProt Consortium] Mouse gene identity: 90% Rat gene identity: 90%