IL-17A Protein, Recombinant, Rabbit, aa21-153, GST-Tag (Il17a)

IL-17A Protein, Recombinant, Rabbit, aa21-153, GST-Tag (Il17a)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
373779.20 20 µg - -

3 - 19 Werktage*

636,00 €
373779.100 100 µg - -

3 - 19 Werktage*

985,00 €
 
Source:|Recombinant protein corresponding to aa21-153 from rabbit IL-17A Protein, fused to... mehr
Produktinformationen "IL-17A Protein, Recombinant, Rabbit, aa21-153, GST-Tag (Il17a)"
Source:, Recombinant protein corresponding to aa21-153 from rabbit IL-17A Protein, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~42.3kD, AA Sequence: VKNGIAMPRNPGCPNAEDKNFPQNVKVSLNILNKSVNSRRPSDYYNRSTSPWTLHRNEDRERYPSVIWEAKCRHLGCVNAEGNEDHHMNSVPIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIIHHMA, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: Interleukin 17A
Hersteller: United States Biological
Hersteller-Nr: 373779

Eigenschaften

Konjugat: No
MW: 42,3
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "IL-17A Protein, Recombinant, Rabbit, aa21-153, GST-Tag (Il17a)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen