Zu "G1SLF2" wurden 14 Artikel gefunden!

1 von 2 Seiten
Für die Filterung wurden keine Ergebnisse gefunden!
IL-17A (rabbit) Do-It-Yourself ELISA
IL-17A (rabbit) Do-It-Yourself ELISA

Artikelnummer: DIY0963U-003

The Rabbit IL-17A Do-It-Yourself ELISA contains capture antibody, standard, and detection antibody for development of a Rabbit IL-17A ELISA. The antibodies have been determined to function in an ELISA with the standard provided. Optimal buffers, concentrations, incubation times, incubation temperatures, and methods...
Schlagworte: IL17A
Anwendung: ELISA
Spezies-Reaktivität: rabbit
ab 1.098,00 €
Bewerten
Anti-IL-17A (rabbit)
Anti-IL-17A (rabbit)

Artikelnummer: KP0961U-100

IL-17A is a member of the IL-17 family, which is comprised of 6 members [IL-17A, IL-17B, IL-17C, IL-17D, IL-17E (also called IL-25), and IL-17F]. IL-17 family members are involved in numerous immune regulatory functions, including inducing and mediating proinflammatory responses and allergic responses. IL-17 induces...
Schlagworte: IL17A
Anwendung: WB, ELISA
Wirt: Chicken
Spezies-Reaktivität: rabbit
549,00 €
Bewerten
Anti-IL-17A (rabbit), Biotin conjugated
Anti-IL-17A (rabbit), Biotin conjugated

Artikelnummer: KPB0962U-050

IL-17A is a member of the IL-17 family, which is comprised of 6 members [IL-17A, IL-17B, IL-17C, IL-17D, IL-17E (also called IL-25), and IL-17F]. IL-17 family members are involved in numerous immune regulatory functions, including inducing and mediating proinflammatory responses and allergic responses. IL-17 induces...
Schlagworte: IL17A
Anwendung: WB, ELISA
Wirt: Chicken
Spezies-Reaktivität: rabbit
549,00 €
Bewerten
Interleukin 17A (IL17A), partial, rabbit, recombinant
Interleukin 17A (IL17A), partial, rabbit, recombinant

Artikelnummer: CSB-EP011597RB.1

Organism: Oryctolagus cuniculus (Rabbit). Source: E.coli. Expression Region: 21-153aa. Protein Length: Partial. Tag Info: N-terminal GST-tagged. Target Protein Sequence: VKNGIAMPRN PGCPNAEDKN FPQNVKVSLN ILNKSVNSRR PSDYYNRSTS PWTLHRNEDR ERYPSVIWEA KCRHLGCVNA EGNEDHHMNS VPIQQEILVL RRESQHCPHS FRLEKMLVAV GCTCVTPIIH HMA....
Schlagworte: Interleukin 17A, Recombinant Rabbit Interleukin 17A (IL17A), partial
Anwendung: Activity not tested
Exprimiert in: E.coli
Ursprungsart: rabbit
MW: 42.3 kD
ab 364,00 €
Bewerten
Interleukin 17A (IL17A), partial, rabbit, recombinant
Interleukin 17A (IL17A), partial, rabbit, recombinant

Artikelnummer: CSB-YP011597RB.1

Organism: Oryctolagus cuniculus (Rabbit). Source: Yeast. Expression Region: 21-153aa. Protein Length: Partial. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: VKNGIAMPRN PGCPNAEDKN FPQNVKVSLN ILNKSVNSRR PSDYYNRSTS PWTLHRNEDR ERYPSVIWEA KCRHLGCVNA EGNEDHHMNS VPIQQEILVL RRESQHCPHS FRLEKMLVAV GCTCVTPIIH...
Schlagworte: Interleukin 17A, Recombinant Rabbit Interleukin 17A (IL17A), partial
Anwendung: Activity not tested
Exprimiert in: Yeast
Ursprungsart: rabbit
MW: 17.3 kD
ab 407,00 €
Bewerten
IL-17 Protein, Rabbit, Recombinant (His)
IL-17 Protein, Rabbit, Recombinant (His)

Artikelnummer: TGM-TMPY-04609-100ug

Description: IL-17 Protein, Rabbit, Recombinant (His) is expressed in Baculovirus insect cells with His tag. The predicted molecular weight is 17.3 kDa and the accession number is G1SLF2.
Schlagworte: interleukin 17A
MW: 17.3 kD
677,00 €
Bewerten
IL-17 Protein, Rabbit, Recombinant
IL-17 Protein, Rabbit, Recombinant

Artikelnummer: TGM-TMPY-04888-100ug

Description: IL-17 Protein, Rabbit, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 15.1 kDa and the accession number is G1SLF2.
Schlagworte: interleukin 17A
MW: 15.1 kD
748,00 €
Bewerten
NEU
IL-17 Protein, Rabbit, Recombinant (His)
IL-17 Protein, Rabbit, Recombinant (His)

Artikelnummer: TGM-TMPY-04609-10ug

Description: IL-17 Protein, Rabbit, Recombinant (His) is expressed in Baculovirus insect cells with His tag. The predicted molecular weight is 17.3 kDa and the accession number is G1SLF2.
Schlagworte: interleukin 17A
MW: 17.3 kD
ab 65,00 €
Bewerten
NEU
IL-17 Protein, Rabbit, Recombinant
IL-17 Protein, Rabbit, Recombinant

Artikelnummer: TGM-TMPY-04888-10ug

Description: IL-17 Protein, Rabbit, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 15.1 kDa and the accession number is G1SLF2.
Schlagworte: interleukin 17A
MW: 15.1 kD
ab 73,00 €
Bewerten
Rabbit Interleukin 17, IL-17 ELISA Kit
Rabbit Interleukin 17, IL-17 ELISA Kit

Artikelnummer: CSB-E08058Rb.48

Sample Types: serum, plasma, tissue homogenates Detection Range: 31.25 pg/mL-2000 pg/mL Sensitivity: 7.81 pg/mL Assay Principle: quantitative Measurement: SandwichAssay Time: 1-5h Sample Volume: 50-100ulDetection Wavelength: 450 nm
Schlagworte: Interleukin 17A
Anwendung: ELISA, Sandwich ELISA
Spezies-Reaktivität: rabbit
ab 421,00 €
Bewerten
Il17a, Recombinant, Rabbit, aa21-153, His-Tag (IL-17A Protein)
Il17a, Recombinant, Rabbit, aa21-153, His-Tag (IL-17A...

Artikelnummer: 373794.100

Source:, Recombinant protein corresponding to aa21-153 from rabbit Il17a, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~17.3kD, AA Sequence: VKNGIAMPRNPGCPNAEDKNFPQNVKVSLNILNKSVNSRRPSDYYNRSTSPWTLHRNEDRERYPSVIWEAKCRHLGCVNAEGNEDHHMNSVPIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIIHHMA, Storage and...
Schlagworte: Interleukin 17A
MW: 17,3
ab 707,00 €
Bewerten
IL-17A Protein, Recombinant, Rabbit, aa21-153, GST-Tag (Il17a)
IL-17A Protein, Recombinant, Rabbit, aa21-153, GST-Tag...

Artikelnummer: 373779.100

Source:, Recombinant protein corresponding to aa21-153 from rabbit IL-17A Protein, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~42.3kD, AA Sequence: VKNGIAMPRNPGCPNAEDKNFPQNVKVSLNILNKSVNSRRPSDYYNRSTSPWTLHRNEDRERYPSVIWEAKCRHLGCVNAEGNEDHHMNSVPIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIIHHMA,...
Schlagworte: Interleukin 17A
MW: 42,3
ab 786,00 €
Bewerten
1 von 2 Seiten