- Suchergebnis für G1SLF2
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "G1SLF2" wurden 14 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: DIY0963U-003
The Rabbit IL-17A Do-It-Yourself ELISA contains capture antibody, standard, and detection antibody for development of a Rabbit IL-17A ELISA. The antibodies have been determined to function in an ELISA with the standard provided. Optimal buffers, concentrations, incubation times, incubation temperatures, and methods...
| Schlagworte: | IL17A |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | rabbit |
ab 1.098,00 €
Artikelnummer: KP0961U-100
IL-17A is a member of the IL-17 family, which is comprised of 6 members [IL-17A, IL-17B, IL-17C, IL-17D, IL-17E (also called IL-25), and IL-17F]. IL-17 family members are involved in numerous immune regulatory functions, including inducing and mediating proinflammatory responses and allergic responses. IL-17 induces...
| Schlagworte: | IL17A |
| Anwendung: | WB, ELISA |
| Wirt: | Chicken |
| Spezies-Reaktivität: | rabbit |
549,00 €
Artikelnummer: KPB0962U-050
IL-17A is a member of the IL-17 family, which is comprised of 6 members [IL-17A, IL-17B, IL-17C, IL-17D, IL-17E (also called IL-25), and IL-17F]. IL-17 family members are involved in numerous immune regulatory functions, including inducing and mediating proinflammatory responses and allergic responses. IL-17 induces...
| Schlagworte: | IL17A |
| Anwendung: | WB, ELISA |
| Wirt: | Chicken |
| Spezies-Reaktivität: | rabbit |
549,00 €
Artikelnummer: CSB-EP011597RB.1
Organism: Oryctolagus cuniculus (Rabbit). Source: E.coli. Expression Region: 21-153aa. Protein Length: Partial. Tag Info: N-terminal GST-tagged. Target Protein Sequence: VKNGIAMPRN PGCPNAEDKN FPQNVKVSLN ILNKSVNSRR PSDYYNRSTS PWTLHRNEDR ERYPSVIWEA KCRHLGCVNA EGNEDHHMNS VPIQQEILVL RRESQHCPHS FRLEKMLVAV GCTCVTPIIH HMA....
| Schlagworte: | Interleukin 17A, Recombinant Rabbit Interleukin 17A (IL17A), partial |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | rabbit |
| MW: | 42.3 kD |
ab 364,00 €
Artikelnummer: CSB-YP011597RB.1
Organism: Oryctolagus cuniculus (Rabbit). Source: Yeast. Expression Region: 21-153aa. Protein Length: Partial. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: VKNGIAMPRN PGCPNAEDKN FPQNVKVSLN ILNKSVNSRR PSDYYNRSTS PWTLHRNEDR ERYPSVIWEA KCRHLGCVNA EGNEDHHMNS VPIQQEILVL RRESQHCPHS FRLEKMLVAV GCTCVTPIIH...
| Schlagworte: | Interleukin 17A, Recombinant Rabbit Interleukin 17A (IL17A), partial |
| Anwendung: | Activity not tested |
| Exprimiert in: | Yeast |
| Ursprungsart: | rabbit |
| MW: | 17.3 kD |
ab 407,00 €
Artikelnummer: TGM-TMPY-04609-100ug
Description: IL-17 Protein, Rabbit, Recombinant (His) is expressed in Baculovirus insect cells with His tag. The predicted molecular weight is 17.3 kDa and the accession number is G1SLF2.
| Schlagworte: | interleukin 17A |
| MW: | 17.3 kD |
677,00 €
Artikelnummer: TGM-TMPY-04888-100ug
Description: IL-17 Protein, Rabbit, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 15.1 kDa and the accession number is G1SLF2.
| Schlagworte: | interleukin 17A |
| MW: | 15.1 kD |
748,00 €
NEU
Artikelnummer: TGM-TMPY-04609-10ug
Description: IL-17 Protein, Rabbit, Recombinant (His) is expressed in Baculovirus insect cells with His tag. The predicted molecular weight is 17.3 kDa and the accession number is G1SLF2.
| Schlagworte: | interleukin 17A |
| MW: | 17.3 kD |
ab 65,00 €
NEU
Artikelnummer: TGM-TMPY-04888-10ug
Description: IL-17 Protein, Rabbit, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 15.1 kDa and the accession number is G1SLF2.
| Schlagworte: | interleukin 17A |
| MW: | 15.1 kD |
ab 73,00 €
Artikelnummer: CSB-E08058Rb.48
Sample Types: serum, plasma, tissue homogenates Detection Range: 31.25 pg/mL-2000 pg/mL Sensitivity: 7.81 pg/mL Assay Principle: quantitative Measurement: SandwichAssay Time: 1-5h Sample Volume: 50-100ulDetection Wavelength: 450 nm
| Schlagworte: | Interleukin 17A |
| Anwendung: | ELISA, Sandwich ELISA |
| Spezies-Reaktivität: | rabbit |
ab 421,00 €
Artikelnummer: 373794.100
Source:, Recombinant protein corresponding to aa21-153 from rabbit Il17a, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~17.3kD, AA Sequence: VKNGIAMPRNPGCPNAEDKNFPQNVKVSLNILNKSVNSRRPSDYYNRSTSPWTLHRNEDRERYPSVIWEAKCRHLGCVNAEGNEDHHMNSVPIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIIHHMA, Storage and...
| Schlagworte: | Interleukin 17A |
| MW: | 17,3 |
ab 707,00 €
Artikelnummer: 373779.100
Source:, Recombinant protein corresponding to aa21-153 from rabbit IL-17A Protein, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~42.3kD, AA Sequence: VKNGIAMPRNPGCPNAEDKNFPQNVKVSLNILNKSVNSRRPSDYYNRSTSPWTLHRNEDRERYPSVIWEAKCRHLGCVNAEGNEDHHMNSVPIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIIHHMA,...
| Schlagworte: | Interleukin 17A |
| MW: | 42,3 |
ab 786,00 €