Zu "G1SLF2" wurden 5 Artikel gefunden!

Für die Filterung wurden keine Ergebnisse gefunden!
IL-17A (rabbit) Do-It-Yourself ELISA
IL-17A (rabbit) Do-It-Yourself ELISA

Artikelnummer: DIY0963U-003

The Rabbit IL-17A Do-It-Yourself ELISA contains capture antibody, standard, and detection antibody for development of a Rabbit IL-17A ELISA. The antibodies have been determined to function in an ELISA with the standard provided. Optimal buffers, concentrations, incubation times, incubation temperatures, and methods...
Schlagworte: IL17A
Anwendung: ELISA
Spezies-Reaktivität: rabbit
ab 1.056,00 €
Bewerten
Anti-IL-17A (rabbit)
Anti-IL-17A (rabbit)

Artikelnummer: KP0961U-100

IL-17A is a member of the IL-17 family, which is comprised of 6 members [IL-17A, IL-17B, IL-17C, IL-17D, IL-17E (also called IL-25), and IL-17F]. IL-17 family members are involved in numerous immune regulatory functions, including inducing and mediating proinflammatory responses and allergic responses. IL-17 induces...
Schlagworte: IL17A
Anwendung: WB, ELISA
Wirt: Chicken
Spezies-Reaktivität: rabbit
521,00 €
Bewerten
Anti-IL-17A (rabbit), Biotin conjugated
Anti-IL-17A (rabbit), Biotin conjugated

Artikelnummer: KPB0962U-050

IL-17A is a member of the IL-17 family, which is comprised of 6 members [IL-17A, IL-17B, IL-17C, IL-17D, IL-17E (also called IL-25), and IL-17F]. IL-17 family members are involved in numerous immune regulatory functions, including inducing and mediating proinflammatory responses and allergic responses. IL-17 induces...
Schlagworte: IL17A
Anwendung: WB, ELISA
Wirt: Chicken
Spezies-Reaktivität: rabbit
535,00 €
Bewerten
Il17a, Recombinant, Rabbit, aa21-153, His-Tag (IL-17A Protein)
Il17a, Recombinant, Rabbit, aa21-153, His-Tag (IL-17A...

Artikelnummer: 373794.100

Source:, Recombinant protein corresponding to aa21-153 from rabbit Il17a, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~17.3kD, AA Sequence: VKNGIAMPRNPGCPNAEDKNFPQNVKVSLNILNKSVNSRRPSDYYNRSTSPWTLHRNEDRERYPSVIWEAKCRHLGCVNAEGNEDHHMNSVPIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIIHHMA, Storage and...
Schlagworte: Interleukin 17A
MW: 17,3
ab 675,00 €
Bewerten
IL-17A Protein, Recombinant, Rabbit, aa21-153, GST-Tag (Il17a)
IL-17A Protein, Recombinant, Rabbit, aa21-153, GST-Tag...

Artikelnummer: 373779.100

Source:, Recombinant protein corresponding to aa21-153 from rabbit IL-17A Protein, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~42.3kD, AA Sequence: VKNGIAMPRNPGCPNAEDKNFPQNVKVSLNILNKSVNSRRPSDYYNRSTSPWTLHRNEDRERYPSVIWEAKCRHLGCVNAEGNEDHHMNSVPIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIIHHMA,...
Schlagworte: Interleukin 17A
MW: 42,3
ab 636,00 €
Bewerten