Anti-STAT2

Anti-STAT2
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG40763.50 50 µg - -

6 - 14 Werktage*

520,00 €
 
Protein function: Signal transducer and activator of transcription that mediates signaling by... mehr
Produktinformationen "Anti-STAT2"
Protein function: Signal transducer and activator of transcription that mediates signaling by type I IFNs (IFN-alpha and IFN-beta). Following type I IFN binding to cell surface receptors, Jak kinases (TYK2 and JAK1) are activated, leading to tyrosine phosphorylation of STAT1 and STAT2. The phosphorylated STATs dimerize, associate with IRF9/ISGF3G to form a complex termed ISGF3 transcription factor, that enters the nucleus. ISGF3 binds to the IFN stimulated response element (ISRE) to activate the transcription of interferon stimulated genes, which drive the cell in an antiviral state (PubMed:9020188, PubMed:23391734). Acts as a regulator of mitochondrial fission by modulating the phosphorylation of DNM1L at 'Ser-616' and 'Ser-637' which activate and inactivate the GTPase activity of DNM1L respectively (PubMed:26122121). [The UniProt Consortium]
Schlagworte: Anti-p113, Anti-STAT2, Anti-Signal transducer and activator of transcription 2
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG40763

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: mouse, rat (Erwartet: human)
Immunogen: Synthetic peptide corresponding to a sequence of Human STAT2. (FQDQLHQLYSHSLLPVDIRQYLAVWIEDQNWQEA)
MW: 97 kD

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-STAT2"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen