Anti-RRM2

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG59132.50 50 µg - -

6 - 14 Werktage*

520,00 €
 
Protein function: Provides the precursors necessary for DNA synthesis. Catalyzes the biosynthesis... mehr
Produktinformationen "Anti-RRM2"
Protein function: Provides the precursors necessary for DNA synthesis. Catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides. Inhibits Wnt signaling. [The UniProt Consortium]
Schlagworte: Anti-RR2, Anti-RRM2, EC=1.17.4.1, Anti-Ribonucleotide reductase small chain, Anti-Ribonucleotide reductase small subunit, Anti-Ribonucleoside-diphosphate reductase subunit M2
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG59132

Eigenschaften

Anwendung: IHC (paraffin), WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Synthetic peptide corresponding to aa. 1-33 of Human RRM2. (MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENT)
MW: 45 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-RRM2"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen