Anti-RBBP4 / RbAp48

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG59042.50 50 µg - -

6 - 14 Werktage*

520,00 €
 
Protein function: Core histone-binding subunit that may target chromatin assembly factors,... mehr
Produktinformationen "Anti-RBBP4 / RbAp48"
Protein function: Core histone-binding subunit that may target chromatin assembly factors, chromatin remodeling factors and histone deacetylases to their histone substrates in a manner that is regulated by nucleosomal DNA. Component of several complexes which regulate chromatin metabolism. These include the chromatin assembly factor 1 (CAF-1) complex, which is required for chromatin assembly following DNA replication and DNA repair, the core histone deacetylase (HDAC) complex, which promotes histone deacetylation and consequent transcriptional repression, the nucleosome remodeling and histone deacetylase complex (the NuRD complex), which promotes transcriptional repression by histone deacetylation and nucleosome remodeling, the PRC2/EED-EZH2 complex, which promotes repression of homeotic genes during development, and the NURF (nucleosome remodeling factor) complex. [The UniProt Consortium]
Schlagworte: Anti-RBBP4, Anti-RBAP48, Anti-RBBP-4, Anti-CAF-I p48, Anti-CAF-1 subunit C, Anti-CAF-I 48 kDa subunit, Anti-Histone-binding protein RBBP4, Anti-Retinoblastoma-binding protein 4, Anti-Retinoblastoma-binding protein p48
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG59042

Eigenschaften

Anwendung: IHC (paraffin), WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat (Erwartet: hamster)
Immunogen: Synthetic peptide corresponding to aa. 395-425 of Human RbAp48 (EDNIMQVWQMAENIYNDEDPEGSVDPEGQGS)
MW: 48 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-RBBP4 / RbAp48"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen