Anti-RAB14

Anti-RAB14
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG59337.50 50 µg - -

6 - 14 Werktage*

520,00 €
 
Protein function: Involved in membrane trafficking between the Golgi complex and endosomes during... mehr
Produktinformationen "Anti-RAB14"
Protein function: Involved in membrane trafficking between the Golgi complex and endosomes during early embryonic development. Regulates the Golgi to endosome transport of FGFR-containing vesicles during early development, a key process for developing basement membrane and epiblast and primitive endoderm lineages during early postimplantation development. May act by modulating the kinesin KIF16B-cargo association to endosomes. Regulates, together with its guanine nucleotide exchange factor DENND6A, the specific endocytic transport of ADAM10, N- cadherin/CDH2 shedding and cell-cell adhesion. [The UniProt Consortium]
Schlagworte: Anti-RAB14, Anti-Ras-related protein Rab-14
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG59337

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, rat (Erwartet: hamster)
Immunogen: Synthetic peptide corresponding to aa. 124-153 of Human RAB14. (NKADLEAQRDVTYEEAKQFAEENGLLFLEA)
MW: 24 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-RAB14"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen