Anti-RAB14

Anti-RAB14
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32156 100 µg - -

3 - 10 Werktage

503,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Ras-related protein Rab-14 is a protein... mehr
Produktinformationen "Anti-RAB14"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Ras-related protein Rab-14 is a protein that in humans is encoded by the RAB14 gene. It is mapped to 9q33.2 based on an alignment of the RAB14 sequence with the genomic sequence. RAB14 belongs to the large RAB family of low molecular mass GTPases that are involved in intracellular membrane trafficking. These proteins act as molecular switches that flip between an inactive GDP-bound state and an active GTP-bound state in which they recruit downstream effector proteins onto membranes. Protein function: Involved in membrane trafficking between the Golgi complex and endosomes during early embryonic development. Regulates the Golgi to endosome transport of FGFR-containing vesicles during early development, a key process for developing basement membrane and epiblast and primitive endoderm lineages during early postimplantation development. May act by modulating the kinesin KIF16B-cargo association to endosomes. Regulates, together with its guanine nucleotide exchange factor DENND6A, the specific endocytic transport of ADAM10, N- cadherin/CDH2 shedding and cell-cell adhesion. [The UniProt Consortium]
Schlagworte: Anti-RAB14, Anti-Ras-related protein Rab-14, RAB14 Antibody
Hersteller-Nr: R32156

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Wirt: Rabbit
Reaktivität: Human, Rat
Immunogen: Amino acids NKADLEAQRDVTYEEAKQFAEENGLLFLEA of human RAB14 were used as the immunogen for the RAB14 antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-RAB14"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen