Anti-NFIB / NF1B2

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG59017.50 50 µg - -

6 - 14 Werktage*

520,00 €
 
Protein function: Transcriptional activator of GFAP, essential for proper brain development... mehr
Produktinformationen "Anti-NFIB / NF1B2"
Protein function: Transcriptional activator of GFAP, essential for proper brain development (PubMed:30388402). Recognizes and binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. These proteins are individually capable of activating transcription and replication. [The UniProt Consortium]
Schlagworte: Anti-CTF, Anti-NFIB, Anti-NFI-B, Anti-NF1-B, Anti-NF-I/B, Anti-Nuclear factor 1/B, Anti-Nuclear factor I/B, Anti-TGGCA-binding protein, Anti-Nuclear factor 1 B-type, Anti-CCAAT-box-binding transcription factor
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG59017

Eigenschaften

Anwendung: IHC (paraffin), WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Synthetic peptide corresponding to a sequence of Human NFIB / NF1B2 (ELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQR)
MW: 47 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-NFIB / NF1B2"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen