Anti-NFIB / Nuclear factor 1 B-type

Artikelnummer	Größe	Datenblatt	Manual	SDB	Lieferzeit	Menge	Preis
NSJ-RQ4312	100 µg		-	-	3 - 10 Werktage*		755,00 €

Bei Fragen nutzen Sie gerne unser Kontaktformular.
Bestellen Sie auch per E-Mail: info@biomol.com
Größere Menge gewünscht? Bulk-Anfrage

0.5mg/ml if reconstituted with 0.2ml sterile DI water. Recognizes and binds the palindromic... mehr

Menü schließen

Produktinformationen "Anti-NFIB / Nuclear factor 1 B-type"

0.5mg/ml if reconstituted with 0.2ml sterile DI water. Recognizes and binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. These proteins are individually capable of activating transcription and replication. [UniProt] Protein function: Recognizes and binds the palindromic sequence 5'- TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. These proteins are individually capable of activating transcription and replication. [The UniProt Consortium]

Schlagworte:	Anti-CTF, Anti-NFIB, Anti-NFI-B, Anti-NF1-B, Anti-NF-I/B, Anti-Nuclear factor 1/B, Anti-Nuclear factor I/B, Anti-TGGCA-binding protein, Anti-Nuclear factor 1 B-type, Anti-CCAAT-box-binding transcription factor, NFIB Antibody / Nuclear factor 1 B-type
Hersteller:	NSJ Bioreagents
Hersteller-Nr:	RQ4312

Eigenschaften

Anwendung:	WB, IHC (paraffin)
Antikörper-Typ:	Polyclonal
Konjugat:	No
Wirt:	Rabbit
Spezies-Reaktivität:	human, mouse, rat
Immunogen:	Amino acids ELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQR were used as the immunogen for the NFIB antibody.
Format:	Purified

Datenbank Information

KEGG ID :	K09169 \| Passende Produkte
UniProt ID :	O00712 \| Passende Produkte
Gene ID	GeneID 4781 \| Passende Produkte

Handhabung & Sicherheit

Lagerung:	+4°C
Versand:	+4°C (International: +4°C)

Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!

Hier folgen Informationen zur Produktreferenz. mehr

Menü schließen

View product citations for antibody RQ4312 on CiteAb

Hier kriegen Sie ein Zertifikat

Zurück

Loggen Sie sich ein oder registrieren Sie sich, um Analysenzertifikate anzufordern.

Bewertungen lesen, schreiben und diskutieren... mehr

Menü schließen

Kundenbewertungen für "Anti-NFIB / Nuclear factor 1 B-type"

Bewertung schreiben

Loggen Sie sich ein oder registrieren Sie sich, um eine Produktbewertung abzugeben.