Anti-Mmp12

Anti-Mmp12
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32074 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Matrix metalloproteinase-12 (MMP12), also... mehr
Produktinformationen "Anti-Mmp12"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Matrix metalloproteinase-12 (MMP12), also known as MME or ME, is an enzyme that in humans is encoded by the MMP12 gene. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.2. It is thought that the protein encoded by this gene is cleaved at both ends to yield the active enzyme, but this processing has not been fully described. The enzyme degrades soluble and insoluble elastin. It may play a role in aneurysm formation and studies in mice suggest a role in the development of emphysema. This gene may involved in tissue injury and remodeling. Protein function: May be involved in tissue injury and remodeling. Has significant elastolytic activity. Can accept large and small amino acids at the P1' site, but has a preference for leucine. Aromatic or hydrophobic residues are preferred at the P1 site, with small hydrophobic residues (preferably alanine) occupying P3. [The UniProt Consortium]
Schlagworte: Anti-MME, Anti-Mme, Anti-Mmp12, Anti-MMP-12, EC=3.4.24.65, Anti-Macrophage metalloelastase, Anti-Matrix metalloproteinase-12, Mmp12 Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32074

Eigenschaften

Anwendung: WB, ELISA
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: mouse
Immunogen: Amino acids KIDAVLYFKRHYYIFQGAYQLEYDPLFRRVTKTLK of mouse Mmp-12 were used as the immunogen for the Mmp-12 antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Mmp12"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen