Anti-MDM4 / MDMX

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG59046.50 50 µg - -

6 - 14 Werktage*

520,00 €
 
Protein function: Inhibits p53/TP53- and TP73/p73-mediated cell cycle arrest and apoptosis by... mehr
Produktinformationen "Anti-MDM4 / MDMX"
Protein function: Inhibits p53/TP53- and TP73/p73-mediated cell cycle arrest and apoptosis by binding its transcriptional activation domain. Inhibits degradation of MDM2. Can reverse MDM2-targeted degradation of TP53 while maintaining suppression of TP53 transactivation and apoptotic functions. [The UniProt Consortium]
Schlagworte: Anti-MDMX, Anti-MDM4, Anti-Protein Mdm4, Anti-Protein Mdmx, Anti-Double minute 4 protein, Anti-p53-binding protein Mdm4, Anti-Mdm2-like p53-binding protein
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG59046

Eigenschaften

Anwendung: IHC (paraffin), WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse (Erwartet: bovine, horse, monkey, rabbit)
Immunogen: Synthetic peptide corresponding to aa. 35-72 of Human MDMX (KILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQH)
MW: 55 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-MDM4 / MDMX"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen