Anti-MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1)(Clone: 2F6)

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ABE-36-1423-100 100 µg -

3 - 11 Werktage*

853,00 €
 
Mitogen-activated protein (MAP) kinase cascades are activated by various extracellular stimuli,... mehr
Produktinformationen "Anti-MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1)(Clone: 2F6)"
Mitogen-activated protein (MAP) kinase cascades are activated by various extracellular stimuli, including growth factors. The MEK kinases (also designated MAP kinase kinase kinases, MKKKs, MAP3Ks or MEKKs) phosphorylate and thereby activate the MEKs (also called MAP kinase kinases or MKKs), including ERK, JNK and p38. These activated MEKs in turn phosphorylate and activate the MAP kinases. The MEK kinases include Raf-1, Raf-B, Mos, MEK kinase-1, MEK kinase-2, MEK kinase-3, MEK kinase-4 and ASK 1 (MEK kinase- 5). MEK kinase-1 activates the ERK and c-Jun NH2-terminal kinase (JNK) pathways by phosphorylation of MAP2K1 and MAP2K4, and also activates the central protein kinases of the NFkB pathway, CHUK and IKBKB. Additionally, MEK kinase-1 uses an E3 ligase through its PHD domain, a RING-finger-like structure, to target proteins for degradation through ubiquitination. Protein function: Component of a protein kinase signal transduction cascade (PubMed:9808624). Activates the ERK and JNK kinase pathways by phosphorylation of MAP2K1 and MAP2K4 (PubMed:9808624). May phosphorylate the MAPK8/JNK1 kinase (PubMed:17761173). Activates CHUK and IKBKB, the central protein kinases of the NF- kappa-B pathway (PubMed:9808624). [The UniProt Consortium]
Schlagworte: Anti-MEKK 1, Anti-MAP3K1, Anti-MAPKKK1, EC=2.7.11.25, Anti-MEK kinase 1, Anti-MAPK/ERK kinase kinase 1, Anti-Mitogen-activated protein kinase kinase kinase 1, Monoclonal Antibody to MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1)(Clone: 2F6)
Hersteller: Abeomics
Hersteller-Nr: 36-1423

Eigenschaften

Anwendung: FC, IF, WB, IHC
Antikörper-Typ: Monoclonal
Klon: 2F6
Konjugat: No
Wirt: Mouse
Spezies-Reaktivität: human
Immunogen: Partial recombinant MAP3K1 (aa1211-1310) (SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTP-VEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK)
Format: Affinity Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1)(Clone: 2F6)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen