Anti-Lysozyme / LYZ

Anti-Lysozyme / LYZ
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32157 100 µg - -

3 - 10 Werktage

503,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. In humans, the lysozyme enzyme is encoded... mehr
Produktinformationen "Anti-Lysozyme / LYZ"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. In humans, the lysozyme enzyme is encoded by the LYZ gene. This gene encodes human lysozyme, whose natural substrate is the bacterial cell wall peptidoglycan (cleaving the beta [1-4] glycosidic linkages between N-acetylmuramic acid and N-acetylglucosamine). Lysozyme is one of the antimicrobial agents found in human milk, and is also present in spleen, lung, kidney, white blood cells, plasma, saliva, and tears. The protein has antibacterial activity against a number of bacterial species. Missense mutations in this gene have been identified in heritable renal amyloidosis. Protein function: Lysozymes have primarily a bacteriolytic function, those in tissues and body fluids are associated with the monocyte- macrophage system and enhance the activity of immunoagents. [The UniProt Consortium]
Schlagworte: Anti-LYZ, Anti-LZM, Anti-Lysozyme C, EC=3.2.1.17, Anti-1,4-beta-N-acetylmuramidase C, Lysozyme Antibody / LYZ
Hersteller-Nr: R32157

Eigenschaften

Anwendung: WB, IHC (paraffin)
Antikörper-Typ: Polyclonal
Wirt: Rabbit
Reaktivität: Human, Rat
Immunogen: Amino acids NIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQ of human LYZ were used as the immunogen for the Lysozyme antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Lysozyme / LYZ"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen