Anti-Lysozyme

Anti-Lysozyme
Anti-Lysozyme
   
%
Rabattaktion
Aktion:

Sichern Sie sich 30% Rabatt auf alle Primärantikörper von Arigo Biolaboratories!

*1
*1 Angebot gültig bis zum 16.12.2024
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Rabatt Preis
ARG40281.50 50 µg - -

6 - 14 Werktage*

30 %
520,00 €
364,00 €
 
Protein function: Lysozymes have primarily a bacteriolytic function, those in tissues and body... mehr
Produktinformationen "Anti-Lysozyme"
Protein function: Lysozymes have primarily a bacteriolytic function, those in tissues and body fluids are associated with the monocyte- macrophage system and enhance the activity of immunoagents. [The UniProt Consortium]
Schlagworte: Anti-LYZ, Anti-LZM, Anti-Lysozyme C, EC=3.2.1.17, Anti-1,4-beta-N-acetylmuramidase C
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG40281

Eigenschaften

Anwendung: IHC (paraffin), WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, rat
Immunogen: Synthetic peptide corresponding to aa. 106-141 of Human Lysozyme. (NIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQ)
MW: 16.5 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Lysozyme"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen