Anti-IBSP / Bone Sialoprotein

Anti-IBSP / Bone Sialoprotein
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG58797.50 50 µg - -

6 - 14 Werktage*

520,00 €
 
Protein function: Binds tightly to hydroxyapatite. Appears to form an integral part of the... mehr
Produktinformationen "Anti-IBSP / Bone Sialoprotein"
Protein function: Binds tightly to hydroxyapatite. Appears to form an integral part of the mineralized matrix. Probably important to cell-matrix interaction. Promotes Arg-Gly-Asp-dependent cell attachment. [The UniProt Consortium]
Schlagworte: Anti-BNSP, Anti-IBSP, Anti-BSP II, Anti-Bone sialoprotein 2, Anti-Bone sialoprotein II, Anti-Cell-binding sialoprotein, Anti-Integrin-binding sialoprotein
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG58797

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Synthetic peptide corresponding to a sequence of Human IBSP (FSMKNLHRRVKIEDSEENGVFKYRPRYYLYKHAYFYPHLKRFPVQ)
MW: 35 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-IBSP / Bone Sialoprotein"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen