Anti-IBSP / Bone Sialoprotein 2

Anti-IBSP / Bone Sialoprotein 2
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32939 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. IBSP (integrin-binding sialoprotein) is... mehr
Produktinformationen "Anti-IBSP / Bone Sialoprotein 2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. IBSP (integrin-binding sialoprotein) is also known as BSP. The protein encoded by this gene is a major structural protein of the bone matrix. Bone sialoprotein is an acidic glycoprotein of approximately 70 kD that undergoes extensive posttranslational modifications. It constitutes approximately 12% of the noncollagenous proteins in human bone and is synthesized by skeletal-associated cell types, including hypertrophic chondrocytes, osteoblasts, osteocytes, and osteoclasts. The only extraskeletal site of its synthesis is the trophoblast. This protein binds to calcium and hydroxyapatite via its acidic amino acid clusters, and mediates cell attachment through an RGD sequence that recognizes the vitronectin receptor. The BSP gene is mapped to 4q22.1. Protein function: Binds tightly to hydroxyapatite. Appears to form an integral part of the mineralized matrix. Probably important to cell-matrix interaction. Promotes Arg-Gly-Asp-dependent cell attachment. [The UniProt Consortium]
Schlagworte: Anti-IBSP, Anti-BNSP, Anti-BSP II, Anti-Bone sialoprotein 2, Anti-Bone sialoprotein II, Anti-Cell-binding sialoprotein, Anti-Integrin-binding sialoprotein, IBSP Antibody / Bone Sialoprotein 2
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32939

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids FSMKNLHRRVKIEDSEENGVFKYRPRYYLYKHAYFYPHLKRFPVQ were used as the immunogen for the IBSP antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-IBSP / Bone Sialoprotein 2"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen