Anti-Hypoxia Inducible Factor 2a (Hypoxia Inducible Factor 2 alpha, Hypoxia-inducible Factor 2-alpha

Anti-Hypoxia Inducible Factor 2a (Hypoxia Inducible Factor 2 alpha, Hypoxia-inducible Factor 2-alpha
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
H9810-01R.100 100 µg - -

3 - 19 Werktage*

718,00 €
 
Hypoxia-inducible factor-2 alpha (HIF-2 alpha) is a transcription factor involved in the... mehr
Produktinformationen "Anti-Hypoxia Inducible Factor 2a (Hypoxia Inducible Factor 2 alpha, Hypoxia-inducible Factor 2-alpha"
Hypoxia-inducible factor-2 alpha (HIF-2 alpha) is a transcription factor involved in the induction of oxygen regulated genes. HIF-2 alpha binds to a specific core DNA sequence within the hypoxia response element of target gene promoters. Applications: Suitable for use in Western Blot and Immunohistochemistry. Other applications not tested. , Recommended Dilution: Western Blot: 1ug/ml, Immunohistochemistry (Paraffin and Formalin): 0.5-1ug/ml, Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: Anti-Hypoxia-inducible factor 2-alpha, Anti-Endothelial PAS domain-containing protein 1
Hersteller: United States Biological
Hersteller-Nr: H9810-01R

Eigenschaften

Anwendung: IHC, WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: rat
Immunogen: Synthetic peptide corresponding to aa202-240, YNNCPPHSSLCGYKEPLLSCLIIMCEPIQHPSHMDIPLD to rat Hypoxia-inducible factor-2 alpha.
Format: Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Hypoxia Inducible Factor 2a (Hypoxia Inducible Factor 2 alpha, Hypoxia-inducible Factor 2-alpha"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen