Anti-FOXA3

Anti-FOXA3
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG58834.50 50 µg - -

6 - 14 Werktage*

520,00 €
 
Protein function: Transcription factor that is thought to act as a 'pioneer' factor opening the... mehr
Produktinformationen "Anti-FOXA3"
Protein function: Transcription factor that is thought to act as a 'pioneer' factor opening the compacted chromatin for other proteins through interactions with nucleosomal core histones and thereby replacing linker histones at target enhancer and/or promoter sites. Originally described as a transcription activator for a number of liver genes such as AFP, albumin, tyrosine aminotransferase, PEPCK, etc. Interacts with the cis-acting regulatory regions of these genes. Involved in glucose homeostasis, binds to and activates transcription from the G6PC promoter. Binds to the CYP3A4 promoter and activates its transcription in cooperation with CEBPA. Binds to the CYP3A7 promoter together with members of the CTF/NF-I family. Involved in regulation of neuronal-specific transcription. May be involved in regulation of spermatogenesis. [The UniProt Consortium]
Schlagworte: Anti-FOXA3, Anti-HNF3G, Anti-HNF-3G, Anti-TCF-3G, Anti-HNF-3-gamma, Anti-Transcription factor 3G, Anti-Forkhead box protein A3, Anti-Fork head-related protein FKH H3, Anti-Hepatocyte nuclear factor 3-gamma
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG58834

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat (Erwartet: hamster)
Immunogen: Synthetic peptide corresponding to aa. 291-324 of Human FOXA3 (ELKLDAPYNFNHPFSINNLMSEQTPAPPKLDVGF)
MW: 37 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-FOXA3"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen