Anti-FOXA3

Anti-FOXA3
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32147 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Hepatocyte nuclear factor 3-gamma... mehr
Produktinformationen "Anti-FOXA3"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Hepatocyte nuclear factor 3-gamma (HNF-3G), also known as forkhead box protein A3 (FOXA3) or transcription factor 3G (TCF-3G), is a protein that in humans is encoded by the FOXA3 gene. This gene is mapped to 19q13.32. HNF-3G is a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. The crystal structure of a similar protein in rat has been resolved. Protein function: Transcription factor that is thought to act as a 'pioneer' factor opening the compacted chromatin for other proteins through interactions with nucleosomal core histones and thereby replacing linker histones at target enhancer and/or promoter sites. Originally described as a transcription activator for a number of liver genes such as AFP, albumin, tyrosine aminotransferase, PEPCK, etc. Interacts with the cis-acting regulatory regions of these genes. Involved in glucose homeostasis, binds to and activates transcription from the G6PC promoter. Binds to the CYP3A4 promoter and activates its transcription in cooperation with CEBPA. Binds to the CYP3A7 promoter together with members of the CTF/NF-I family. Involved in regulation of neuronal-specific transcription. May be involved in regulation of spermatogenesis. [The UniProt Consortium]
Schlagworte: Anti-FOXA3, Anti-HNF3G, Anti-HNF-3G, Anti-TCF-3G, Anti-HNF-3-gamma, Anti-Forkhead box protein A3, Anti-Transcription factor 3G, Anti-Fork head-related protein FKH H3, Anti-Hepatocyte nuclear factor 3-gamma, FOXA3 Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32147

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids ELKLDAPYNFNHPFSINNLMSEQTPAPPKLDVGF of human FOXA3 were used as the immunogen for the FOXA3 antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-FOXA3"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen