Anti-FMRP / FMR1

Anti-FMRP / FMR1
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32195 100 µg - -

3 - 10 Werktage

503,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. FMR1 (fragile X mental retardation 1) is a... mehr
Produktinformationen "Anti-FMRP / FMR1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. FMR1 (fragile X mental retardation 1) is a human gene that codes for a protein called fragile X mental retardation protein, or FMRP. This protein, most commonly found in the brain, is essential for normalcognitive developmentand female reproductive function. Mutations of this gene can lead to fragile X syndrome, mental retardation, premature ovarian failure, autism, Parkinson's disease, developmental delays and other cognitive deficits. The protein encoded by this gene binds RNA and is associated with polysomes. Additionally, the encoded protein may be involved in mRNA trafficking from the nucleus to the cytoplasm. A trinucleotide repeat (CGG) in the 5' UTR is normally found at 6-53 copies, but an expansion to 55-230 repeats is the cause of fragile X syndrome. Expansion of the trinucleotide repeat may also cause one form of premature ovarian failure (POF1). Multiple alternatively spliced transcript variants that encode different protein isoforms and which are located in different cellular locations have been described for this gene. Protein function: Translation repressor. Component of the CYFIP1-EIF4E- FMR1 complex which binds to the mRNA cap and mediates translational repression. In the CYFIP1-EIF4E-FMR1 complex this subunit mediates translation repression. RNA- binding protein that plays a role in intracellular RNA transport and in the regulation of translation of target mRNAs. Associated with polysomes. May play a role in the transport of mRNA from the nucleus to the cytoplasm. Binds strongly to poly(G), binds moderately to poly(U) but shows very little binding to poly(A) or poly(C). [The UniProt Consortium]
Schlagworte: Anti-FMRP, Anti-FMR1, Anti-Protein FMR-1, Anti-Fragile X mental retardation protein 1, FMRP Antibody / FMR1
Hersteller-Nr: R32195

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Wirt: Rabbit
Reaktivität: Human, Mouse, Rat
Immunogen: Amino acids ENYQLVILSINEVTSKRAHMLIDMHFRSLRTKLSLIM of human FMRP were used as the immunogen for the FMRP antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-FMRP / FMR1"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen