Anti-ERp57 / PDIA3

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32052 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. PDIA3 (Protein disulfide isomerase family... mehr
Produktinformationen "Anti-ERp57 / PDIA3"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. PDIA3 (Protein disulfide isomerase family A, member 3), also called GRP58, Erp57 or ER60, is an isomerase enzyme. It is mapped on 15q15.3. PDIA3 is also part of the major histocompatibility complex (MHC) class I peptide-loading complex, which is essential for formation of the final antigen conformation and export from the endoplasmic reticulum to the cell surface. This gene encodes a protein of the endoplasmic reticulum that interacts with lectin chaperones calreticulin and calnexin to modulate folding of newly synthesized glycoproteins. The protein was once thought to be a phospholipase, however, it has been demonstrated that the protein actually has protein disulfide isomerase activity. It is thought that complexes of lectins and this protein mediate protein folding by promoting formation of disulfide bonds in their glycoprotein substrates.
Schlagworte: Anti-p58, Anti-PDIA3, Anti-ERp57, Anti-ERp60, Anti-ERP57, EC=5.3.4.1, Anti-ER protein 60, Anti-ER protein 57, Anti-Disulfide isomerase ER-60, Anti-58 kDa microsomal protein, Anti-Protein disulfide-isomerase A3, Anti-58 kDa glucose-regulated protein, ERp57
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32052

Eigenschaften

Anwendung: WB, IHC (paraffin), IHC (frozen)
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids RELSDFISYLQREATNPPVIQEEKPKKKKKAQEDL of human PDIA3/ERp57 were used as the immunogen for the PDIA3 antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-ERp57 / PDIA3"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen