Anti-Beta Tubulin, clone 2E11.

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-RQ5619 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Tubulin beta chain is a protein that in... mehr
Produktinformationen "Anti-Beta Tubulin, clone 2E11."
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Tubulin beta chain is a protein that in humans is encoded by the TUBB gene. This gene encodes a beta tubulin protein. This protein forms a dimer with alpha tubulin and acts as a structural component of microtubules. Mutations in this gene cause cortical dysplasia, complex, with other brain malformations 6. Alternative splicing results in multiple splice variants. There are multiple pseudogenes for this gene on chromosomes 1, 6, 7, 8, 9, and 13. Protein function: Tubulin is the major constituent of microtubules, a cylinder consisting of laterally associated linear protofilaments composed of alpha- and beta-tubulin heterodimers. Microtubules grow by the addition of GTP-tubulin dimers to the microtubule end, where a stabilizing cap forms. Below the cap, tubulin dimers are in GDP-bound state, owing to GTPase activity of alpha-tubulin. [The UniProt Consortium]
Schlagworte: Anti-TUBB, Anti-TUBB5, Anti-Tubulin beta chain, Anti-Tubulin beta-5 chain, Beta Tubulin Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: RQ5619

Eigenschaften

Anwendung: WB, FC, ICC
Antikörper-Typ: Monoclonal
Klon: 2E11.
Konjugat: No
Wirt: Mouse
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids EQFTAMFRRKAFLHWYTGEGMDEMEFTEAE
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Beta Tubulin, clone 2E11."
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen