Anti-ASPH / Aspartate Beta Hydroxylase

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG58312.50 50 µg - -

6 - 14 Werktage*

520,00 €
 
Protein function: Isoform 1: specifically hydroxylates an Asp or Asn residue in certain epidermal... mehr
Produktinformationen "Anti-ASPH / Aspartate Beta Hydroxylase"
Protein function: Isoform 1: specifically hydroxylates an Asp or Asn residue in certain epidermal growth factor-like (EGF) domains of a number of proteins. [The UniProt Consortium]
Schlagworte: Anti-BAH, Anti-ASPH, Anti-ASP beta-hydroxylase, Anti-Aspartate beta-hydroxylase, Anti-Peptide-aspartate beta-dioxygenase, Anti-Aspartyl/asparaginyl beta-hydroxylase
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG58312

Eigenschaften

Anwendung: IHC (paraffin), WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat (Erwartet: hamster)
Immunogen: Synthetic peptide corresponding to a sequence at the C-terminus of Human ASPH (726-758aa EVWQDASSFRLIFIVDVWHPELTPQQRRSLPAI), identical to the related Mouse sequence
MW: 86 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-ASPH / Aspartate Beta Hydroxylase"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen