Anti-ASPH

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32203 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. ASPH is also known as Aspartyl/asparaginyl... mehr
Produktinformationen "Anti-ASPH"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. ASPH is also known as Aspartyl/asparaginyl beta-hydroxylase or aspartate beta-hydroxylase. This gene is thought to play an important role in calcium homeostasis. And the gene is expressed from two promoters and undergoes extensive alternative splicing. The encoded set of proteins share varying amounts of overlap near their N-termini but have substantial variations in their C-terminal domains resulting in distinct functional properties. The longest isoforms (a and f) include a C-terminal Aspartyl/Asparaginyl beta-hydroxylase domain that hydroxylates aspartic acid or asparagine residues in the epidermal growth factor (EGF)-like domains of some proteins, including protein C, coagulation factors VII, IX, and X, and the complement factors C1R and C1S. Other isoforms differ primarily in the C-terminal sequence and lack the hydroxylase domain, and some have been localized to the endoplasmic and sarcoplasmic reticulum. Some of these isoforms are found in complexes with calsequestrin, triadin, and the ryanodine receptor, and have been shown to regulate calcium release from the sarcoplasmic reticulum. Some isoforms have been implicated in metastasis. Protein function: Isoform 1: specifically hydroxylates an Asp or Asn residue in certain epidermal growth factor-like (EGF) domains of a number of proteins. [The UniProt Consortium]
Schlagworte: Anti-BAH, Anti-ASPH, Anti-ASP beta-hydroxylase, Anti-Aspartate beta-hydroxylase, Anti-Peptide-aspartate beta-dioxygenase, Anti-Aspartyl/asparaginyl beta-hydroxylase, ASPH Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32203

Eigenschaften

Anwendung: WB, IHC (paraffin), ICC
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids EVWQDASSFRLIFIVDVWHPELTPQQRRSLPAI of human ASPH
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-ASPH"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen