Anti-14-3-3 zeta / YWHAZ

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-RQ4280 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. 14-3-3 protein zeta/delta is a protein... mehr
Produktinformationen "Anti-14-3-3 zeta / YWHAZ"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. 14-3-3 protein zeta/delta is a protein that in humans is encoded by the YWHAZ gene on chromosome 8. This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Several transcript variants that differ in the 5' UTR but that encode the same protein have been identified for this gene. Protein function: Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. [The UniProt Consortium]
Schlagworte: Anti-YWHAZ, Anti-KCIP-1, Anti-14-3-3 protein zeta/delta, Anti-Protein kinase C inhibitor protein 1, 14-3-3 zeta Antibody / YWHAZ
Hersteller: NSJ Bioreagents
Hersteller-Nr: RQ4280

Eigenschaften

Anwendung: WB, IHC (paraffin), IF/ICC
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids LLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQ
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-14-3-3 zeta / YWHAZ"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen