Products from Atlas Antibodies

Atlas Antibodies

Atlas Antibodies AB from Stockholm (Sweden) aims to make the unique antibodies used in the Human Protein Atlas project available to all interested researchers. Based on the idea to create a complete map of human protein expression and localization, the project developed its own set of highly specific antibodies that met the quality demands of such an ambitious project. These unique antibodies were made commercially available in 2006 by Atlas Antibodies as Triple A (Atlas Antibodies Advanced) Polyclonals. Since then, Atlas Antibodies has also introduced PrecisA Monoclonals (the swedish word "precisa" stands for precise, accurate and targeted) and PrEST Antigens (recombinant human Protein Epitope Signature Tags). All of these products are based on the same high-quality manufacturing principles.

More information at: www.atlasantibodies.com

Go to the catalogs of Atlas Antibodies

3840 from 3843 pages
No results were found for the filter!
CTSW PrEST Antigen
CTSW PrEST Antigen

Item number: ATA-APrEST95971.100

PrEST Antigen CTSW, Gene description: cathepsin W, Antigen sequence: EEFGQLYGYRRAAGGVPSMGREIRSEEPEESVPFSCDWRKVAGAISPIKDQKNCNCCWAMAAAGNIETLWRISFWD, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May have a specific function in the mechanism or regulation of T-cell...
Keywords: CTSW, Lymphopain, Cathepsin W, EC=3.4.22.-
Expressed in: E.coli
Origin: human
264.00€ *
Review
PSTPIP1 PrEST Antigen
PSTPIP1 PrEST Antigen

Item number: ATA-APrEST95974.100

PrEST Antigen PSTPIP1, Gene description: proline-serine-threonine phosphatase interacting protein 1, Alternative Gene Names: CD2BP1, CD2BP1L, CD2BP1S, H-PIP, PAPAS, PSTPIP, Antigen sequence: LTILRNALWVHSNQLSMQCVKDDELYEEVRLTLEGCSIDADIDSFIQAKSTGTEPPAPVPYQNYYDREVTPLTSSPGIQPSC, Storage: Upon delivery store at -20°C....
Keywords: H-PIP, CD2BP1, PSTPIP1, CD2-binding protein 1, PEST phosphatase-interacting protein 1, Proline-serine-threonine...
Expressed in: E.coli
Origin: human
264.00€ *
Review
LMX1B PrEST Antigen
LMX1B PrEST Antigen

Item number: ATA-APrEST95979.100

PrEST Antigen LMX1B, Gene description: LIM homeobox transcription factor 1 beta, Alternative Gene Names: NPS1, Antigen sequence: YEKEKDLLSSVSPDESDSVKSEDEDGDMKPAKGQGSQSKGSG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Essential for the specification of dorsal limb fate...
Keywords: LMX1B, LMX-1.2, LIM/homeobox protein 1.2, LIM/homeobox protein LMX1B, LIM homeobox transcription factor 1-beta
Expressed in: E.coli
Origin: human
264.00€ *
Review
TEKT3 PrEST Antigen
TEKT3 PrEST Antigen

Item number: ATA-APrEST95992.100

PrEST Antigen TEKT3, Gene description: tektin 3, Alternative Gene Names: FLJ32828, Antigen sequence: REKRMGIDLVHDEVEAQLLTEVDTILCCQERMKLHLDKAIAQLAANRASQHELEKDLSDKQTAYRIDDKCHHLRNTSDGVGYFRGVERVDATVS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May be a structural...
Keywords: TEKT3, Tektin-3
Expressed in: E.coli
Origin: human
264.00€ *
Review
IFI16 PrEST Antigen
IFI16 PrEST Antigen

Item number: ATA-APrEST96000.100

PrEST Antigen IFI16, Gene description: interferon gamma inducible protein 16, Alternative Gene Names: IFNGIP1, PYHIN2, Antigen sequence: STPSSSFLTTKSEDTISKMNDFMRMQILKEGSHFPGPFMTSIGPAESHPHTPQMPP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Binds double-stranded DNA....
Keywords: IFI16, Ifi-16, IFNGIP1, Gamma-interferon-inducible protein 16, Interferon-inducible myeloid differentiation...
Expressed in: E.coli
Origin: human
264.00€ *
Review
FAM186A PrEST Antigen
FAM186A PrEST Antigen

Item number: ATA-APrEST96004.100

PrEST Antigen FAM186A, Gene description: family with sequence similarity 186 member A, Alternative Gene Names: LOC121006, Antigen sequence: DFKVAQVPFTTKKFQMSEVSDTSEETQILRDTFAIESFRTFQSHFTKYRTPVYQTPYTDERALLTLMKPTTSPSSLTTLLRT, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene...
Keywords: FAM186A, Protein FAM186A
Expressed in: E.coli
Origin: human
264.00€ *
Review
KMT5C PrEST Antigen
KMT5C PrEST Antigen

Item number: ATA-APrEST96006.100

PrEST Antigen KMT5C, Gene description: lysine methyltransferase 5C, Alternative Gene Names: MGC2705, SUV420H2, Antigen sequence: THKMNVSPVPPLRRQQHLRSALETFLRQRDLEAAYRALTLGGWTARYFQSR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Histone methyltransferase that specifically...
Keywords: PP7130, SUV420H2, Suv4-20h2, Su(var)4-20 homolog 2, Lysine N-methyltransferase 5C, Lysine-specific methyltransferase 5C,...
Expressed in: E.coli
Origin: human
264.00€ *
Review
NOXRED1 PrEST Antigen
NOXRED1 PrEST Antigen

Item number: ATA-APrEST96008.100

PrEST Antigen NOXRED1, Gene description: NADP dependent oxidoreductase domain containing 1, Alternative Gene Names: C14orf148, FLJ32809, Antigen sequence: LGIKCFYHNADLVSWADVIFLCCLPSQLPNICVEIYTSLEKASIVYSFVAAIPLPRLKLLLNHTNILRPQYQYDEDSVSVWGANKGVIAALQDPTILQATC, Storage: Upon delivery store at -20°C. Avoid repeated...
Keywords: NOXRED1, C14orf148, EC=1.-.-.-, Pyrroline-5-carboxylate reductase-like protein C14orf148, NADP-dependent oxidoreductase...
Expressed in: E.coli
Origin: human
264.00€ *
Review
OVOL3 PrEST Antigen
OVOL3 PrEST Antigen

Item number: ATA-APrEST96013.100

PrEST Antigen OVOL3, Gene description: ovo like zinc finger 3, Alternative Gene Names: HOVO3, Antigen sequence: CSLEAHLAKVHGQPASYAYRERREKLHVCEDCGFTSSRPDTYAQH, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May act as a transcription regulator. [The UniProt Consortium]...
Keywords: OVOL3, Putative transcription factor ovo-like protein 3
Expressed in: E.coli
Origin: human
264.00€ *
Review
CREB3L1 PrEST Antigen
CREB3L1 PrEST Antigen

Item number: ATA-APrEST96019.100

PrEST Antigen CREB3L1, Gene description: cAMP responsive element binding protein 3 like 1, Alternative Gene Names: OASIS, Antigen sequence: MATTPLLGLSPLSRLPIPHQAPGEMTQLPVIKAEPLEVNQFLKVTPEDLVQMPPTP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Transcription factor...
Keywords: OASIS, CREB3L1, PSEC0238
Expressed in: E.coli
Origin: human
264.00€ *
Review
PLPPR2 PrEST Antigen
PLPPR2 PrEST Antigen

Item number: ATA-APrEST96020.100

PrEST Antigen PLPPR2, Gene description: phospholipid phosphatase related 2, Alternative Gene Names: LPPR2, PRG-4, Antigen sequence: YTALGCLPPSPDRPGPDRFVTDQGACAGSPSLVAAARRAFPCKDAA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 96% Rat gene identity: 96%
Keywords: PRG-4, EC=3.1.3.4, Plasticity-related gene 4 protein, Phospholipid phosphatase-related protein type 2, Lipid phosphate...
Expressed in: E.coli
Origin: human
264.00€ *
Review
NPPB PrEST Antigen
NPPB PrEST Antigen

Item number: ATA-APrEST96026.100

PrEST Antigen NPPB, Gene description: natriuretic peptide B, Antigen sequence: LGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSRE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: [Brain natriuretic peptide 32]: Cardiac hormone that plays a key role in mediating...
Keywords: NPPB
Expressed in: E.coli
Origin: human
264.00€ *
Review
3840 from 3843 pages