TEKT3 PrEST Antigen

TEKT3 PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST95992.100 100 µl

3 - 8 business days*

264.00€
 
PrEST Antigen TEKT3, Gene description: tektin 3, Alternative Gene Names: FLJ32828, Antigen... more
Product information "TEKT3 PrEST Antigen"
PrEST Antigen TEKT3, Gene description: tektin 3, Alternative Gene Names: FLJ32828, Antigen sequence: REKRMGIDLVHDEVEAQLLTEVDTILCCQERMKLHLDKAIAQLAANRASQHELEKDLSDKQTAYRIDDKCHHLRNTSDGVGYFRGVERVDATVS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May be a structural component of the sperm flagellum. Required for normal sperm mobility. [The UniProt Consortium] Mouse gene identity: 83% Rat gene identity: 83%
Keywords: TEKT3, Tektin-3
Supplier: Atlas Antibodies
Supplier-Nr: APrEST95992

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "TEKT3 PrEST Antigen"
Write a review
or to review a product.
Viewed