Products from Atlas Antibodies

Atlas Antibodies

Atlas Antibodies AB from Stockholm (Sweden) aims to make the unique antibodies used in the Human Protein Atlas project available to all interested researchers. Based on the idea to create a complete map of human protein expression and localization, the project developed its own set of highly specific antibodies that met the quality demands of such an ambitious project. These unique antibodies were made commercially available in 2006 by Atlas Antibodies as Triple A (Atlas Antibodies Advanced) Polyclonals. Since then, Atlas Antibodies has also introduced PrecisA Monoclonals (the swedish word "precisa" stands for precise, accurate and targeted) and PrEST Antigens (recombinant human Protein Epitope Signature Tags). All of these products are based on the same high-quality manufacturing principles.

More information at: www.atlasantibodies.com

Go to the catalogs of Atlas Antibodies

3838 from 3843 pages
No results were found for the filter!
DEDD PrEST Antigen
DEDD PrEST Antigen

Item number: ATA-APrEST95851.100

PrEST Antigen DEDD, Gene description: death effector domain containing, Alternative Gene Names: CASP8IP1, DEDD1, DEFT, FLDED1, KE05, Antigen sequence: PEPRPPQPSKTVPPHYPVVCCPTSGPQMCSKRPARGRATLGSQRKRRKSVTPDPKEKQTCDI, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: A scaffold...
Keywords: KE05, DEDD, FLDED-1, DEDPRO1, DEDPro1, Death effector domain-containing protein, Death effector domain-containing...
Expressed in: E.coli
Origin: human
264.00€ *
Review
CCDC169 PrEST Antigen
CCDC169 PrEST Antigen

Item number: ATA-APrEST95859.100

PrEST Antigen CCDC169, Gene description: coiled-coil domain containing 169, Alternative Gene Names: C13orf38, LOC728591, RP11-251J8.1, Antigen sequence: VKTLLLKEELDPLKVSCLETLGFSAAGVAGPENRTCLGQKALWPACLHGSSTLAVCQTHL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 33% Rat...
Keywords: CCDC169, C13orf38, Coiled-coil domain-containing protein 169
Expressed in: E.coli
Origin: human
264.00€ *
Review
ZNF175 PrEST Antigen
ZNF175 PrEST Antigen

Item number: ATA-APrEST95863.100

PrEST Antigen ZNF175, Gene description: zinc finger protein 175, Alternative Gene Names: OTK18, Antigen sequence: LYSHLFAVGYHIPNPEVIFRMLKEKEPRVEEAEVSHQRCQEREFGLEIPQKEISKKASFQKDMVGEFTRD, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Down-regulates the expression of...
Keywords: ZNF175, Zinc finger protein 175, Zinc finger protein OTK18
Expressed in: E.coli
Origin: human
264.00€ *
Review
FAM120C PrEST Antigen
FAM120C PrEST Antigen

Item number: ATA-APrEST95866.100

PrEST Antigen FAM120C, Gene description: family with sequence similarity 120C, Alternative Gene Names: CXorf17, FLJ20506, ORF34, Antigen sequence: NWAVSYDSSASQFPNYLPSKASPPLGPDSSHSSSSDGDEPNGASSDHITEAFHHQPEWGNPNRDRGSWAQPVDTGVSEA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene...
Keywords: CXorf17, FAM120C, Protein FAM120C, Tumor antigen BJ-HCC-21, Constitutive coactivator of PPAR-gamma-like protein 2
Expressed in: E.coli
Origin: human
264.00€ *
Review
SLX9 PrEST Antigen
SLX9 PrEST Antigen

Item number: ATA-APrEST95873.100

PrEST Antigen SLX9, Gene description: SLX9 ribosome biogenesis factor, Alternative Gene Names: C21orf70, FAM207A, PRED56, Antigen sequence: KLAEQKHREERRRRATVVVGHLHPLRDALPELLGLEAGSRRQACSRESNKPWPSELSRMSAAQRQQLLEE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 72% Rat...
Keywords: PRED56, FAM207A, C21orf70, Protein FAM207A
Expressed in: E.coli
Origin: human
264.00€ *
Review
GPR148 PrEST Antigen
GPR148 PrEST Antigen

Item number: ATA-APrEST95876.100

PrEST Antigen GPR148, Gene description: G protein-coupled receptor 148, Alternative Gene Names: PGR6, Antigen sequence: LSKWQDAQLEEQGASYILPPSMGTQPGC, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Orphan receptor. [The UniProt Consortium] Mouse gene identity: 39% Rat gene...
Keywords: BTR, GPR148, G-protein coupled receptor PGR6, Brain and testis restricted GPCR, Probable G-protein coupled receptor 148
Expressed in: E.coli
Origin: human
264.00€ *
Review
SHOC1 PrEST Antigen
SHOC1 PrEST Antigen

Item number: ATA-APrEST95882.100

PrEST Antigen SHOC1, Gene description: shortage in chiasmata 1, Alternative Gene Names: C9orf84, FLJ32779, MZIP2, Zip2, Antigen sequence: LTNKHGIEDIGDIKFSSTEILTIQSQSEPEECSKPGELEMPLTPLFLTCQHSSVNSLRTELQTFPLSPVCKI, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: ATPase...
Keywords: MZIP2, Protein ZIP2 homolog, Protein shortage in chiasmata 1 ortholog
Expressed in: E.coli
Origin: human
264.00€ *
Review
RALBP1 PrEST Antigen
RALBP1 PrEST Antigen

Item number: ATA-APrEST95891.100

PrEST Antigen RALBP1, Gene description: ralA binding protein 1, Alternative Gene Names: RIP, RIP1, RLIP76, Antigen sequence: PPDVVSDDEKDHGKKKGKFKKKEKRTEGYAAFQEDSSGDEAESPSKMKRSKGIHVFKKPSFSKKKEKDFKIKEKPKEEKHKEEKHKEEKHKEKKSKDLTAADVVKQWKEKKKKKKPIQEPEVPQIDVPNLKP, Storage: Upon delivery store at -20°C. Avoid repeated...
Keywords: RLIP1, RalBP1, RALBP1, DNP-SG ATPase, RalA-binding protein 1, Ral-interacting protein 1, 76 kDa Ral-interacting protein,...
Expressed in: E.coli
Origin: human
264.00€ *
Review
DCLK3 PrEST Antigen
DCLK3 PrEST Antigen

Item number: ATA-APrEST95892.100

PrEST Antigen DCLK3, Gene description: doublecortin like kinase 3, Alternative Gene Names: DCAMKL3, DCDC3C, KIAA1765, Antigen sequence: PRNPTQELRRPSKSMDKKEDRGPEDQESHAQGAAKAKKDLVEVLPVTEEGLREVKKDTRPMSRSKHGGWLLREHQAGFEKLRRTRGEEKEAEKEKKPCMSGGRRMTLRDDQPAKL, Storage: Upon delivery store at -20°C. Avoid repeated...
Keywords: DCLK3, DCAMKL3, EC=2.7.11.1, Doublecortin-like kinase 3, Serine/threonine-protein kinase DCLK3, Doublecortin-like and CAM...
Expressed in: E.coli
Origin: human
264.00€ *
Review
IGLV6-57 PrEST Antigen
IGLV6-57 PrEST Antigen

Item number: ATA-APrEST95900.100

PrEST Antigen IGLV6-57, Gene description: immunoglobulin lambda variable 6-57, Antigen sequence: HSVSESPGKTVTISCTRSSGSIASNYVQWYQQRPGSAPTTVIYEDNQRPSGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDSSNHTVL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: V region of the variable domain...
Keywords: Ig lambda chain V-VI region AR, Ig lambda chain V-VI region EB4, Ig lambda chain V-VI region WLT, Ig lambda chain V-VI...
Expressed in: E.coli
Origin: human
264.00€ *
Review
PDPK1 PrEST Antigen
PDPK1 PrEST Antigen

Item number: ATA-APrEST95901.100

PrEST Antigen PDPK1, Gene description: 3-phosphoinositide dependent protein kinase 1, Alternative Gene Names: PDK1, Antigen sequence: LDSNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKI, Storage: Upon delivery store at -20°C. Avoid repeated...
Keywords: PDK1, PDPK1, hPDK1, EC=2.7.11.1, 3-phosphoinositide-dependent protein kinase 1
Expressed in: E.coli
Origin: human
264.00€ *
Review
CRLF2 PrEST Antigen
CRLF2 PrEST Antigen

Item number: ATA-APrEST95938.100

PrEST Antigen CRLF2, Gene description: cytokine receptor like factor 2, Alternative Gene Names: CRL2, TSLPR, Antigen sequence: YRSPFDTEWQSKQENTCNVTIEGLDAEKCYSFWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Receptor for...
Keywords: CRL2, IL-XR, CRLF2, TSLP receptor, Cytokine receptor-like 2, Cytokine receptor-like factor 2, Thymic stromal lymphopoietin...
Expressed in: E.coli
Origin: human
264.00€ *
Review
3838 from 3843 pages