Products from Atlas Antibodies
Atlas Antibodies AB from Stockholm (Sweden) aims to make the unique antibodies used in the Human Protein Atlas project available to all interested researchers. Based on the idea to create a complete map of human protein expression and localization, the project developed its own set of highly specific antibodies that met the quality demands of such an ambitious project. These unique antibodies were made commercially available in 2006 by Atlas Antibodies as Triple A (Atlas Antibodies Advanced) Polyclonals. Since then, Atlas Antibodies has also introduced PrecisA Monoclonals (the swedish word "precisa" stands for precise, accurate and targeted) and PrEST Antigens (recombinant human Protein Epitope Signature Tags). All of these products are based on the same high-quality manufacturing principles.
More information at: www.atlasantibodies.com
No results were found for the filter!
C1orf146 PrEST Antigen
Item number: ATA-APrEST96068.100
PrEST Antigen C1orf146, Gene description: chromosome 1 open reading frame 146, Alternative Gene Names: SPO16, Antigen sequence: VNAINLMCTIAKTTSKPYIDSICYRMITAKAYIIEQSPVWKTLQKIKLNSDSVNP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Plays a key role in reinforcing the...
| Keywords: | C1orf146, Protein SPO16 homolog, Synaptonemal complex reinforcing element |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
C17orf80 PrEST Antigen
Item number: ATA-APrEST96078.100
PrEST Antigen C17orf80, Gene description: chromosome 17 open reading frame 80, Alternative Gene Names: FLJ20721, HLC-8, MIG3, SPEP1, Antigen sequence: KLVVDKPEQTVKTFPLPAVGLERAATTKADKDIKNPIQPSFKMLKNTKPMTTFQEETKAQFYASEKTSPKRELAKDLPKSGESRCNP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles....
| Keywords: | HLC8, HLC-8, C17orf80, Uncharacterized protein C17orf80, Human lung cancer oncogene 8 protein, Cell migration-inducing... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
BCAR1 PrEST Antigen
Item number: ATA-APrEST96092.100
PrEST Antigen BCAR1, Gene description: BCAR1 scaffold protein, Cas family member, Alternative Gene Names: CAS, CASS1, Crkas, P130Cas, Antigen sequence: SGATLEDLDRLVACSRAVPEDAKQLASFLHGNASLLFRRTKATAPGPEGGGTLHPNPTDKTSSIQSRPLPSPPKFTSQDSPDGQYEN, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles....
| Keywords: | CAS, BCAR1, p130cas, CRK-associated substrate, Cas scaffolding protein family member 1, Breast cancer anti-estrogen... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
STK3 PrEST Antigen
Item number: ATA-APrEST96095.100
PrEST Antigen STK3, Gene description: serine/threonine kinase 3, Alternative Gene Names: KRS1, MST2, Antigen sequence: DLITEAMEIKAKRHEEQQRELEEEEENS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Stress-activated, pro-apoptotic kinase which, following caspase-cleavage,...
| Keywords: | STK3, KRS1, EC=2.7.11.1 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
PWWP3A PrEST Antigen
Item number: ATA-APrEST96099.100
PrEST Antigen PWWP3A, Gene description: PWWP domain containing 3A, DNA repair factor, Alternative Gene Names: EXPAND1, MUM-1, MUM1, Antigen sequence: PVRKSIQQDVLGTKLPQLSKGSPEEPVVGCPLGQRQPCRKMLPDRSRAARDRANQKLVEYIVKAKGAESHLRAILKSRKPSRW, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein...
| Keywords: | MUM-1, PWWP3A, Protein expandere, PWWP domain-containing protein MUM1, Mutated melanoma-associated antigen 1, PWWP... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
C20orf96 PrEST Antigen
Item number: ATA-APrEST96112.100
PrEST Antigen C20orf96, Gene description: chromosome 20 open reading frame 96, Alternative Gene Names: dJ1103G7.2, Antigen sequence: KHSGTHSIVQEFQVPDYVPWQQSKQETKPSTLPPVQQANSLHTSKMKTLTRVQPVFHFKPTTVVTSCQPKNPRELHRRRKLDPGKMHAKIWLMKTSLRS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse...
| Keywords: | C20orf96, Uncharacterized protein C20orf96 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
CAD PrEST Antigen
Item number: ATA-APrEST96125.100
PrEST Antigen CAD, Gene description: carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase, Alternative Gene Names: GATD4, Antigen sequence: FSEATSSVQKGESLADSVQTMSCYADVVVLRHPQPGAVELAAKHCRRPVINAGDGVGEHPTQALLDIFTIREELGTVNGMTITMVGDLKHGRTVHSLACLLTQYRVSLRYVAPPSLRMPP, Storage: Upon delivery...
| Keywords: | CAD protein, Dihydroorotase, Aspartate carbamoyltransferase, Glutamine-dependent carbamoyl-phosphate synthase |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
GJC1 PrEST Antigen
Item number: ATA-APrEST96132.100
PrEST Antigen GJC1, Gene description: gap junction protein gamma 1, Alternative Gene Names: CX45, GJA7, Antigen sequence: AKMEHGEADKKAARSKPYAMRWKQHRALEETEEDNEEDPMMYPEMELESDKENKEQSQPKPKHDGRRRIREDGL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: One gap junction consists...
| Keywords: | GJC1, GJA7, Cx45, Connexin-45, Gap junction gamma-1 protein, Gap junction alpha-7 protein |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
CCR9 PrEST Antigen
Item number: ATA-APrEST96133.100
PrEST Antigen CCR9, Gene description: C-C motif chemokine receptor 9, Alternative Gene Names: CDw199, GPR-9-6, GPR28, Antigen sequence: MADDYGSESTSSMEDYVNFNFTDFYCEKNNVRQFASHFL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Receptor for chemokine SCYA25/TECK. Subsequently...
| Keywords: | CCR9, GPR28, CCR-9, CDw199, GPR-9-6, CC-CKR-9, C-C CKR-9, C-C chemokine receptor type 9, G-protein coupled receptor 28 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
ZNF775 PrEST Antigen
Item number: ATA-APrEST96140.100
PrEST Antigen ZNF775, Gene description: zinc finger protein 775, Alternative Gene Names: MGC33584, Antigen sequence: GTGAGLVMKVKQEKPERLLQTLAPQAMLVEKDKENIFQQHRGLPPRQTMGRPRALGGQEESGSPRWAPPTEQDAGLAGRAPGSASGPLSPSLSSG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May be...
| Keywords: | ZNF775, Zinc finger protein 775 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
DNAJC28 PrEST Antigen
Item number: ATA-APrEST96141.100
PrEST Antigen DNAJC28, Gene description: DnaJ heat shock protein family (Hsp40) member C28, Alternative Gene Names: C21orf55, C21orf78, Antigen sequence: VLSHVIEQTNASQSKGEEEEDVEKFKYKTPQHRHYLSFEGIGFGTPTQREKHYRQFRADRAAEQVMEYQKQKLQSQYFPDSVIVKNIRQSKQQKITQAI, Storage: Upon delivery store at -20°C. Avoid repeated...
| Keywords: | DNAJC28, C21orf55, DnaJ homolog subfamily C member 28 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
DND1 PrEST Antigen
Item number: ATA-APrEST96145.100
PrEST Antigen DND1, Gene description: DND microRNA-mediated repression inhibitor 1, Alternative Gene Names: MGC34750, RBMS4, Antigen sequence: MMTFSGLNRGFAYARYSSRRGAQAAIATLHNHPLRPSCPLLVCRSTEKCELSVDGLPPNLTRSALLLALQPLGPGLQE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function:...
| Keywords: | DND1, RBMS4, Dead end protein homolog 1, RNA-binding motif, single-stranded-interacting protein 4 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*